Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2YEA2

Protein Details
Accession A0A0D2YEA2    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
36-61PTQVKMRSASRRPKKVGKKPALPAHVHydrophilic
NLS Segment(s)
PositionSequence
42-55RSASRRPKKVGKKP
Subcellular Location(s) nucl 14.5, cyto_nucl 12.333, mito_nucl 9.666, cyto 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
Amino Acid Sequences MNQAKALPPALTAGLLERRDSTMSNEESLVGLEKTPTQVKMRSASRRPKKVGKKPALPAHVVQARQCHNDVEKQYRTRLKQKFERLLAVLQASKVKDESGGEGDSEAPDCGYSRGEVLDFARQRILALEEENRRLSDQVQHLDRRFTIV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.19
3 0.2
4 0.19
5 0.2
6 0.22
7 0.22
8 0.24
9 0.24
10 0.26
11 0.26
12 0.25
13 0.23
14 0.22
15 0.22
16 0.18
17 0.11
18 0.09
19 0.08
20 0.09
21 0.12
22 0.13
23 0.16
24 0.17
25 0.21
26 0.24
27 0.31
28 0.38
29 0.44
30 0.51
31 0.59
32 0.66
33 0.71
34 0.74
35 0.77
36 0.8
37 0.81
38 0.83
39 0.82
40 0.8
41 0.79
42 0.81
43 0.75
44 0.66
45 0.56
46 0.52
47 0.47
48 0.39
49 0.32
50 0.29
51 0.28
52 0.28
53 0.28
54 0.22
55 0.2
56 0.24
57 0.26
58 0.28
59 0.31
60 0.31
61 0.36
62 0.4
63 0.43
64 0.48
65 0.5
66 0.51
67 0.55
68 0.62
69 0.64
70 0.6
71 0.59
72 0.51
73 0.46
74 0.39
75 0.32
76 0.23
77 0.16
78 0.17
79 0.14
80 0.13
81 0.12
82 0.11
83 0.1
84 0.1
85 0.12
86 0.12
87 0.12
88 0.11
89 0.12
90 0.12
91 0.11
92 0.11
93 0.09
94 0.06
95 0.06
96 0.06
97 0.07
98 0.07
99 0.07
100 0.07
101 0.08
102 0.08
103 0.1
104 0.11
105 0.19
106 0.19
107 0.2
108 0.21
109 0.2
110 0.2
111 0.2
112 0.21
113 0.14
114 0.16
115 0.22
116 0.26
117 0.3
118 0.31
119 0.3
120 0.29
121 0.28
122 0.27
123 0.29
124 0.31
125 0.35
126 0.41
127 0.48
128 0.49
129 0.53