Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XQW4

Protein Details
Accession A0A0D2XQW4    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
4-34RDTYSEPPRSHRQSRRQPPPRRGPPVKQSESHydrophilic
NLS Segment(s)
PositionSequence
15-26RQSRRQPPPRRG
Subcellular Location(s) nucl 20, cyto_nucl 12.5, mito 3, cyto 3
Family & Domain DBs
KEGG fox:FOXG_06363  -  
Amino Acid Sequences MGRRDTYSEPPRSHRQSRRQPPPRRGPPVKQSESGFDWTPGIVLALLGAFTWLSHDFDNYKKKHEHCDDRRGSRNRDSERGRRRYRSSSRYPDDDYDDYDDYDYRGERGYSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.73
2 0.74
3 0.77
4 0.84
5 0.89
6 0.89
7 0.91
8 0.91
9 0.93
10 0.92
11 0.91
12 0.88
13 0.86
14 0.85
15 0.85
16 0.79
17 0.72
18 0.63
19 0.57
20 0.52
21 0.47
22 0.38
23 0.28
24 0.23
25 0.19
26 0.17
27 0.12
28 0.09
29 0.05
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.03
36 0.02
37 0.02
38 0.04
39 0.05
40 0.06
41 0.06
42 0.07
43 0.09
44 0.14
45 0.22
46 0.21
47 0.26
48 0.29
49 0.31
50 0.4
51 0.48
52 0.54
53 0.53
54 0.63
55 0.67
56 0.69
57 0.77
58 0.74
59 0.71
60 0.69
61 0.7
62 0.64
63 0.65
64 0.65
65 0.65
66 0.69
67 0.74
68 0.74
69 0.73
70 0.74
71 0.76
72 0.79
73 0.78
74 0.78
75 0.78
76 0.77
77 0.75
78 0.73
79 0.66
80 0.63
81 0.56
82 0.49
83 0.44
84 0.38
85 0.33
86 0.29
87 0.25
88 0.19
89 0.19
90 0.17
91 0.12
92 0.13