Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XC00

Protein Details
Accession A0A0D2XC00    Localization Confidence Low Confidence Score 7
NoLS Segment(s)
PositionSequenceProtein Nature
126-145LRSWRFSSKKPMRLSTRRLLHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 12.5, cyto_nucl 10.5, nucl 7.5, mito 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR020618  Adenyl_kinase_AK6  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005737  C:cytoplasm  
GO:0005634  C:nucleus  
GO:0004017  F:adenylate kinase activity  
GO:0005524  F:ATP binding  
GO:0016887  F:ATP hydrolysis activity  
GO:0034599  P:cellular response to oxidative stress  
GO:0000462  P:maturation of SSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0016310  P:phosphorylation  
KEGG fox:FOXG_01423  -  
Pfam View protein in Pfam  
PF13238  AAA_18  
Amino Acid Sequences MTTRKLPNIIITGTPGVGKTTHCEALAERTGLRHLSVNQVVKDKECHEGWSDEFHSFIVDEDKLLDAIEDDVKAGGCIIDWHACDLFPKSWIDLVVVLRVDSSTHYDRLITRNLPRVQASKKTSTLRSWRFSSKKPMRLSTRRLLLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.18
3 0.15
4 0.14
5 0.13
6 0.14
7 0.18
8 0.2
9 0.2
10 0.2
11 0.2
12 0.26
13 0.3
14 0.26
15 0.22
16 0.2
17 0.22
18 0.21
19 0.21
20 0.17
21 0.14
22 0.2
23 0.26
24 0.29
25 0.29
26 0.33
27 0.33
28 0.31
29 0.33
30 0.28
31 0.27
32 0.23
33 0.23
34 0.21
35 0.23
36 0.22
37 0.25
38 0.24
39 0.2
40 0.19
41 0.17
42 0.15
43 0.12
44 0.12
45 0.09
46 0.07
47 0.07
48 0.07
49 0.07
50 0.07
51 0.07
52 0.06
53 0.04
54 0.05
55 0.05
56 0.05
57 0.05
58 0.05
59 0.05
60 0.05
61 0.04
62 0.03
63 0.03
64 0.03
65 0.04
66 0.07
67 0.07
68 0.08
69 0.08
70 0.08
71 0.09
72 0.12
73 0.11
74 0.1
75 0.11
76 0.1
77 0.11
78 0.12
79 0.12
80 0.12
81 0.12
82 0.12
83 0.12
84 0.11
85 0.1
86 0.1
87 0.09
88 0.08
89 0.13
90 0.13
91 0.14
92 0.14
93 0.16
94 0.18
95 0.21
96 0.26
97 0.25
98 0.27
99 0.35
100 0.37
101 0.39
102 0.4
103 0.43
104 0.44
105 0.49
106 0.5
107 0.47
108 0.52
109 0.54
110 0.56
111 0.58
112 0.63
113 0.62
114 0.62
115 0.61
116 0.64
117 0.65
118 0.67
119 0.7
120 0.7
121 0.7
122 0.71
123 0.75
124 0.76
125 0.79
126 0.81
127 0.79