Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2Y6K8

Protein Details
Accession A0A0D2Y6K8    Localization Confidence Low Confidence Score 8.2
NoLS Segment(s)
PositionSequenceProtein Nature
13-38LSHIKDSSDRRKKCDRSRPGLSCNFCHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11.5, cyto_nucl 10.5, mito 8, cyto 6.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
CDD cd12148  fungal_TF_MHR  
Amino Acid Sequences MPVCNALHFSRTLSHIKDSSDRRKKCDRSRPGLSCNFCIKRGLDCVGVTDDPAPDTLEKHYESLGNQAEDGRPRRVSSLVVPDAALAEELASLYFRYMHITFHNIFHRATFIAQVKDSSIPKILFFGVAGLSARYSTHPIFTSITPWDRGRPYRDESAYSVI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.32
2 0.32
3 0.34
4 0.4
5 0.46
6 0.53
7 0.58
8 0.59
9 0.6
10 0.69
11 0.75
12 0.78
13 0.8
14 0.79
15 0.78
16 0.85
17 0.85
18 0.83
19 0.82
20 0.75
21 0.7
22 0.69
23 0.62
24 0.52
25 0.48
26 0.4
27 0.35
28 0.35
29 0.32
30 0.25
31 0.22
32 0.23
33 0.23
34 0.22
35 0.19
36 0.16
37 0.13
38 0.11
39 0.11
40 0.1
41 0.07
42 0.08
43 0.09
44 0.12
45 0.12
46 0.13
47 0.13
48 0.13
49 0.13
50 0.18
51 0.19
52 0.16
53 0.15
54 0.15
55 0.16
56 0.19
57 0.22
58 0.2
59 0.18
60 0.18
61 0.2
62 0.2
63 0.2
64 0.18
65 0.23
66 0.21
67 0.2
68 0.2
69 0.18
70 0.17
71 0.16
72 0.13
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.03
79 0.03
80 0.03
81 0.04
82 0.04
83 0.08
84 0.08
85 0.1
86 0.11
87 0.15
88 0.17
89 0.2
90 0.24
91 0.22
92 0.21
93 0.2
94 0.21
95 0.17
96 0.16
97 0.17
98 0.17
99 0.17
100 0.18
101 0.18
102 0.18
103 0.22
104 0.22
105 0.19
106 0.2
107 0.18
108 0.18
109 0.19
110 0.18
111 0.14
112 0.13
113 0.12
114 0.08
115 0.08
116 0.09
117 0.07
118 0.07
119 0.07
120 0.08
121 0.09
122 0.13
123 0.13
124 0.16
125 0.17
126 0.19
127 0.21
128 0.21
129 0.24
130 0.25
131 0.28
132 0.29
133 0.29
134 0.33
135 0.37
136 0.42
137 0.44
138 0.45
139 0.48
140 0.53
141 0.54
142 0.52