Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2YK02

Protein Details
Accession A0A0D2YK02    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
153-174HKIPIGRWPKDKKKKELGTFVGBasic
NLS Segment(s)
PositionSequence
160-167WPKDKKKK
Subcellular Location(s) cyto 10, cyto_nucl 9.666, cyto_mito 9.666, mito_nucl 8.666, nucl 8, mito 8
Family & Domain DBs
InterPro View protein in InterPro  
IPR013216  Methyltransf_11  
IPR029063  SAM-dependent_MTases_sf  
Gene Ontology GO:0008168  F:methyltransferase activity  
Pfam View protein in Pfam  
PF08241  Methyltransf_11  
CDD cd02440  AdoMet_MTases  
Amino Acid Sequences MRVSTANETGLPTTKNNSKHLISYITPTQPSFVPPNVEFQIDDAQLEWTFEPESFDFIHIRYLQGTIGDWDRLYGQMYKALKPGGWFQHIEPDLQMLSQNPEIKVDDEHIFTRWAKVFTQVGETIGCTFDFSNGKLSTLAKDVGFVSVTPQTHKIPIGRWPKDKKKKELGTFVGLSFSQALDGFVKLPLCEILKWSPEEMQLFAAEMRKILMNPKTQAFGHVVYGQKPERPKESSPAAE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.34
3 0.37
4 0.41
5 0.4
6 0.41
7 0.43
8 0.42
9 0.37
10 0.38
11 0.4
12 0.39
13 0.38
14 0.34
15 0.32
16 0.28
17 0.3
18 0.29
19 0.25
20 0.27
21 0.26
22 0.32
23 0.32
24 0.32
25 0.28
26 0.26
27 0.28
28 0.22
29 0.21
30 0.15
31 0.16
32 0.15
33 0.16
34 0.13
35 0.09
36 0.09
37 0.09
38 0.12
39 0.11
40 0.13
41 0.12
42 0.14
43 0.14
44 0.13
45 0.18
46 0.15
47 0.16
48 0.14
49 0.14
50 0.13
51 0.12
52 0.13
53 0.1
54 0.11
55 0.11
56 0.1
57 0.1
58 0.1
59 0.1
60 0.12
61 0.11
62 0.1
63 0.16
64 0.17
65 0.18
66 0.2
67 0.2
68 0.19
69 0.18
70 0.24
71 0.22
72 0.24
73 0.24
74 0.22
75 0.3
76 0.3
77 0.29
78 0.23
79 0.19
80 0.16
81 0.15
82 0.15
83 0.07
84 0.09
85 0.12
86 0.14
87 0.13
88 0.14
89 0.15
90 0.15
91 0.15
92 0.16
93 0.14
94 0.13
95 0.14
96 0.13
97 0.15
98 0.14
99 0.16
100 0.15
101 0.15
102 0.14
103 0.16
104 0.17
105 0.15
106 0.18
107 0.15
108 0.14
109 0.13
110 0.13
111 0.1
112 0.09
113 0.09
114 0.06
115 0.06
116 0.08
117 0.09
118 0.09
119 0.14
120 0.14
121 0.15
122 0.15
123 0.16
124 0.14
125 0.15
126 0.16
127 0.1
128 0.11
129 0.11
130 0.11
131 0.1
132 0.09
133 0.09
134 0.11
135 0.12
136 0.12
137 0.15
138 0.15
139 0.17
140 0.19
141 0.19
142 0.17
143 0.26
144 0.35
145 0.38
146 0.46
147 0.54
148 0.64
149 0.73
150 0.79
151 0.8
152 0.8
153 0.83
154 0.82
155 0.82
156 0.75
157 0.71
158 0.64
159 0.55
160 0.46
161 0.36
162 0.29
163 0.2
164 0.15
165 0.09
166 0.08
167 0.09
168 0.08
169 0.08
170 0.08
171 0.09
172 0.1
173 0.09
174 0.09
175 0.11
176 0.11
177 0.11
178 0.14
179 0.17
180 0.2
181 0.22
182 0.23
183 0.23
184 0.25
185 0.26
186 0.23
187 0.21
188 0.17
189 0.17
190 0.17
191 0.18
192 0.14
193 0.13
194 0.13
195 0.13
196 0.13
197 0.19
198 0.24
199 0.27
200 0.31
201 0.33
202 0.36
203 0.35
204 0.37
205 0.35
206 0.3
207 0.28
208 0.29
209 0.29
210 0.27
211 0.34
212 0.33
213 0.34
214 0.38
215 0.4
216 0.42
217 0.45
218 0.47
219 0.48