Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DJP1

Protein Details
Accession A0A0C4DJP1    Localization Confidence High Confidence Score 15.9
NoLS Segment(s)
PositionSequenceProtein Nature
90-118NQGLKEKGGRPRRNCRVTQKNSRKQSEAVHydrophilic
NLS Segment(s)
PositionSequence
60-64KLKKK
96-101KGGRPR
Subcellular Location(s) nucl 21.5, cyto_nucl 12, mito 3
Family & Domain DBs
KEGG fox:FOXG_17694  -  
Amino Acid Sequences MAPVTPSRPSTARRSQHVTPPKEPRPLAEELQEVPMEIDEEGDIKSPPIHPNSHEDEVKKLKKKLRNLGGATQYPPRQRQEQRQNRAEPNQGLKEKGGRPRRNCRVTQKNSRKQSEAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.58
2 0.59
3 0.65
4 0.7
5 0.68
6 0.67
7 0.7
8 0.7
9 0.71
10 0.66
11 0.59
12 0.54
13 0.52
14 0.45
15 0.38
16 0.34
17 0.27
18 0.29
19 0.26
20 0.21
21 0.16
22 0.14
23 0.11
24 0.08
25 0.07
26 0.04
27 0.05
28 0.05
29 0.06
30 0.06
31 0.05
32 0.07
33 0.09
34 0.12
35 0.14
36 0.16
37 0.16
38 0.22
39 0.28
40 0.31
41 0.31
42 0.29
43 0.31
44 0.37
45 0.42
46 0.42
47 0.41
48 0.44
49 0.48
50 0.56
51 0.61
52 0.61
53 0.64
54 0.62
55 0.63
56 0.63
57 0.58
58 0.51
59 0.46
60 0.42
61 0.37
62 0.38
63 0.35
64 0.38
65 0.42
66 0.51
67 0.58
68 0.64
69 0.7
70 0.74
71 0.78
72 0.76
73 0.75
74 0.71
75 0.65
76 0.61
77 0.6
78 0.54
79 0.48
80 0.43
81 0.45
82 0.44
83 0.49
84 0.52
85 0.53
86 0.6
87 0.69
88 0.78
89 0.79
90 0.82
91 0.83
92 0.84
93 0.84
94 0.87
95 0.87
96 0.87
97 0.89
98 0.88