Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Y450

Protein Details
Accession A0A0D2Y450    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
42-63TALHIRVVRRRRRTVNRESVFSHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 16, E.R. 5, vacu 5
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MVMVIAAAGVGLAIGALASRRPLVAFLTTMFLYIVTLLIVFTALHIRVVRRRRRTVNRESVFSQSTSHPV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.01
2 0.02
3 0.02
4 0.03
5 0.04
6 0.04
7 0.05
8 0.05
9 0.06
10 0.08
11 0.09
12 0.1
13 0.1
14 0.12
15 0.12
16 0.12
17 0.11
18 0.09
19 0.07
20 0.07
21 0.06
22 0.03
23 0.03
24 0.03
25 0.03
26 0.03
27 0.03
28 0.03
29 0.05
30 0.05
31 0.06
32 0.07
33 0.1
34 0.17
35 0.26
36 0.36
37 0.43
38 0.52
39 0.61
40 0.72
41 0.79
42 0.82
43 0.85
44 0.8
45 0.77
46 0.71
47 0.67
48 0.58
49 0.5
50 0.41