Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DJ70

Protein Details
Accession A0A0C4DJ70    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
7-34LSLYNSPHSGRKRRKKCDEVKPQCKGCIHydrophilic
NLS Segment(s)
PositionSequence
17-21RKRRK
Subcellular Location(s) mito 16, nucl 7.5, cyto_nucl 5.5, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
Pfam View protein in Pfam  
PF00172  Zn_clus  
CDD cd00067  GAL4  
Amino Acid Sequences MSVRLLLSLYNSPHSGRKRRKKCDEVKPQCKGCIRNGLECTWPTAADLIADPRRAPLSWKSQPSLHEVLSGLSLQHADYVALLSHFVDSICPRIIRRECRPE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.44
3 0.51
4 0.6
5 0.68
6 0.77
7 0.86
8 0.9
9 0.92
10 0.92
11 0.92
12 0.93
13 0.92
14 0.9
15 0.82
16 0.78
17 0.73
18 0.66
19 0.59
20 0.58
21 0.51
22 0.49
23 0.48
24 0.43
25 0.41
26 0.37
27 0.35
28 0.25
29 0.22
30 0.15
31 0.13
32 0.11
33 0.08
34 0.08
35 0.1
36 0.11
37 0.11
38 0.11
39 0.11
40 0.12
41 0.12
42 0.15
43 0.16
44 0.23
45 0.3
46 0.33
47 0.35
48 0.36
49 0.38
50 0.42
51 0.39
52 0.3
53 0.25
54 0.22
55 0.21
56 0.19
57 0.17
58 0.11
59 0.08
60 0.08
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.06
72 0.06
73 0.06
74 0.08
75 0.09
76 0.12
77 0.16
78 0.17
79 0.18
80 0.28
81 0.36
82 0.43