Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2YCF8

Protein Details
Accession A0A0D2YCF8    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
102-128NPSVDPPTTKRSRRNKHPKTALDPNIRHydrophilic
NLS Segment(s)
PositionSequence
115-115R
Subcellular Location(s) mito 17, nucl 8
Family & Domain DBs
Amino Acid Sequences MRRRLKVPMCEFPTRHICRWVTLAFESVPTGNYAIKLASSAPDAPPKTNTALSFRQTLPLQRGFRFWSNVSLNAVMQDTTPVSLNTKHPRNRSQLRLLLNNNPSVDPPTTKRSRRNKHPKTALDPNIR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.58
3 0.55
4 0.5
5 0.44
6 0.48
7 0.43
8 0.36
9 0.31
10 0.3
11 0.23
12 0.22
13 0.2
14 0.15
15 0.15
16 0.11
17 0.11
18 0.09
19 0.09
20 0.09
21 0.08
22 0.08
23 0.08
24 0.07
25 0.07
26 0.09
27 0.1
28 0.11
29 0.18
30 0.19
31 0.19
32 0.21
33 0.22
34 0.23
35 0.24
36 0.24
37 0.22
38 0.26
39 0.26
40 0.28
41 0.26
42 0.27
43 0.25
44 0.26
45 0.25
46 0.29
47 0.29
48 0.26
49 0.28
50 0.28
51 0.29
52 0.3
53 0.26
54 0.25
55 0.24
56 0.25
57 0.25
58 0.22
59 0.19
60 0.17
61 0.17
62 0.1
63 0.08
64 0.08
65 0.06
66 0.06
67 0.07
68 0.06
69 0.08
70 0.1
71 0.17
72 0.25
73 0.33
74 0.39
75 0.45
76 0.52
77 0.6
78 0.65
79 0.66
80 0.67
81 0.65
82 0.64
83 0.66
84 0.62
85 0.61
86 0.56
87 0.52
88 0.45
89 0.39
90 0.34
91 0.3
92 0.28
93 0.24
94 0.26
95 0.31
96 0.39
97 0.45
98 0.54
99 0.62
100 0.71
101 0.78
102 0.85
103 0.86
104 0.89
105 0.92
106 0.92
107 0.89
108 0.9