Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C4DJ37

Protein Details
Accession A0A0C4DJ37    Localization Confidence Medium Confidence Score 13.6
NoLS Segment(s)
PositionSequenceProtein Nature
42-68AGVKLRSASRKPKRPRKKLAPSLQAREHydrophilic
NLS Segment(s)
PositionSequence
45-60KLRSASRKPKRPRKKL
Subcellular Location(s) nucl 22, cyto_nucl 14.5, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR011598  bHLH_dom  
IPR036638  HLH_DNA-bd_sf  
Gene Ontology GO:0046983  F:protein dimerization activity  
Pfam View protein in Pfam  
PF00010  HLH  
Amino Acid Sequences MQQPSQCHQRTPVSGRGHSNSSTNGHNGIDNIKNEHSGSGFAGVKLRSASRKPKRPRKKLAPSLQARECHNEVEKQYRTRLKLRFESLLAALQTSRTSDDDLRGASASEGKYIQLTSNSC
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.56
2 0.59
3 0.57
4 0.53
5 0.46
6 0.43
7 0.38
8 0.33
9 0.31
10 0.27
11 0.25
12 0.21
13 0.21
14 0.19
15 0.2
16 0.22
17 0.2
18 0.22
19 0.21
20 0.22
21 0.21
22 0.21
23 0.17
24 0.13
25 0.12
26 0.13
27 0.13
28 0.12
29 0.14
30 0.14
31 0.14
32 0.14
33 0.15
34 0.15
35 0.2
36 0.3
37 0.37
38 0.47
39 0.57
40 0.67
41 0.77
42 0.83
43 0.89
44 0.89
45 0.91
46 0.91
47 0.9
48 0.89
49 0.83
50 0.8
51 0.74
52 0.66
53 0.57
54 0.52
55 0.43
56 0.35
57 0.31
58 0.27
59 0.25
60 0.3
61 0.32
62 0.3
63 0.36
64 0.39
65 0.42
66 0.46
67 0.5
68 0.49
69 0.52
70 0.54
71 0.51
72 0.46
73 0.44
74 0.38
75 0.36
76 0.28
77 0.21
78 0.17
79 0.14
80 0.13
81 0.12
82 0.13
83 0.1
84 0.13
85 0.15
86 0.17
87 0.19
88 0.19
89 0.2
90 0.18
91 0.17
92 0.15
93 0.18
94 0.15
95 0.15
96 0.15
97 0.14
98 0.15
99 0.15
100 0.17