Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S8R2

Protein Details
Accession E3S8R2    Localization Confidence Medium Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
23-48TVPLAAQPRRRGRPRGLKNKDKLEVYHydrophilic
NLS Segment(s)
PositionSequence
30-42PRRRGRPRGLKNK
Subcellular Location(s) cyto_nucl 13.5, cyto 13, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR013103  RVT_2  
KEGG pte:PTT_19389  -  
Pfam View protein in Pfam  
PF07727  RVT_2  
Amino Acid Sequences PYYRPDHLWTDPDAPHAPPTDVTVPLAAQPRRRGRPRGLKNKDKLEVYITKKEEADYELAIKLRNDGVITTPGTPFEASDDQEISDLVGRGVFEFEQYDKERHGGIRIFKSRLVREVKGKTTKPYEKSRLVIQGYQDHGKEAILTQSPTIQRCSQRVIMALAPVLVQRGMSIELRDITQAYPQAQTNLQRTILAHLPSELVSKYPEGTLLHVIKPLYGIAEAGVHWWTTYHSHHREELDMSTSTYDPCLLITNGDADAFGLVGMQTDDTLMLGTAVFSSLEEKKLEEAQFRSKPKTVLTPDMQLDFNGCTLTIEKGEAILNLKQKGQGGKIKLVDIKAYDRAQQYTEQRARGA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.34
3 0.33
4 0.29
5 0.23
6 0.28
7 0.25
8 0.24
9 0.24
10 0.21
11 0.19
12 0.22
13 0.3
14 0.28
15 0.31
16 0.39
17 0.48
18 0.57
19 0.65
20 0.68
21 0.71
22 0.78
23 0.83
24 0.85
25 0.86
26 0.87
27 0.88
28 0.89
29 0.85
30 0.76
31 0.67
32 0.63
33 0.61
34 0.58
35 0.58
36 0.51
37 0.47
38 0.45
39 0.44
40 0.38
41 0.33
42 0.28
43 0.2
44 0.2
45 0.2
46 0.2
47 0.21
48 0.19
49 0.18
50 0.16
51 0.16
52 0.14
53 0.12
54 0.14
55 0.16
56 0.18
57 0.17
58 0.17
59 0.16
60 0.17
61 0.16
62 0.14
63 0.15
64 0.16
65 0.15
66 0.17
67 0.17
68 0.16
69 0.16
70 0.16
71 0.11
72 0.11
73 0.1
74 0.08
75 0.08
76 0.08
77 0.08
78 0.09
79 0.09
80 0.07
81 0.08
82 0.09
83 0.14
84 0.16
85 0.17
86 0.17
87 0.18
88 0.2
89 0.19
90 0.23
91 0.22
92 0.26
93 0.34
94 0.38
95 0.39
96 0.4
97 0.46
98 0.42
99 0.45
100 0.45
101 0.39
102 0.43
103 0.47
104 0.52
105 0.55
106 0.55
107 0.53
108 0.56
109 0.6
110 0.58
111 0.62
112 0.61
113 0.58
114 0.58
115 0.57
116 0.56
117 0.5
118 0.46
119 0.39
120 0.38
121 0.35
122 0.36
123 0.31
124 0.24
125 0.21
126 0.19
127 0.16
128 0.11
129 0.11
130 0.1
131 0.1
132 0.1
133 0.14
134 0.16
135 0.17
136 0.2
137 0.21
138 0.23
139 0.25
140 0.3
141 0.28
142 0.27
143 0.27
144 0.26
145 0.22
146 0.19
147 0.17
148 0.12
149 0.1
150 0.08
151 0.07
152 0.05
153 0.04
154 0.04
155 0.04
156 0.06
157 0.06
158 0.06
159 0.07
160 0.07
161 0.08
162 0.08
163 0.08
164 0.07
165 0.08
166 0.09
167 0.09
168 0.11
169 0.11
170 0.12
171 0.13
172 0.17
173 0.18
174 0.19
175 0.18
176 0.17
177 0.17
178 0.19
179 0.21
180 0.17
181 0.15
182 0.13
183 0.13
184 0.13
185 0.14
186 0.11
187 0.08
188 0.08
189 0.08
190 0.08
191 0.08
192 0.09
193 0.09
194 0.1
195 0.15
196 0.17
197 0.17
198 0.18
199 0.18
200 0.16
201 0.16
202 0.14
203 0.09
204 0.07
205 0.06
206 0.05
207 0.06
208 0.05
209 0.06
210 0.06
211 0.06
212 0.05
213 0.06
214 0.07
215 0.09
216 0.13
217 0.21
218 0.26
219 0.29
220 0.32
221 0.34
222 0.35
223 0.33
224 0.31
225 0.25
226 0.21
227 0.18
228 0.17
229 0.16
230 0.14
231 0.12
232 0.11
233 0.08
234 0.07
235 0.09
236 0.08
237 0.08
238 0.08
239 0.1
240 0.09
241 0.09
242 0.09
243 0.06
244 0.06
245 0.05
246 0.05
247 0.03
248 0.03
249 0.03
250 0.04
251 0.03
252 0.03
253 0.04
254 0.04
255 0.04
256 0.04
257 0.04
258 0.04
259 0.03
260 0.04
261 0.04
262 0.04
263 0.04
264 0.04
265 0.08
266 0.09
267 0.12
268 0.12
269 0.13
270 0.15
271 0.21
272 0.24
273 0.26
274 0.28
275 0.35
276 0.43
277 0.47
278 0.5
279 0.48
280 0.48
281 0.46
282 0.52
283 0.48
284 0.49
285 0.48
286 0.49
287 0.48
288 0.48
289 0.45
290 0.35
291 0.31
292 0.23
293 0.19
294 0.13
295 0.11
296 0.09
297 0.1
298 0.12
299 0.11
300 0.11
301 0.11
302 0.12
303 0.12
304 0.13
305 0.15
306 0.18
307 0.23
308 0.24
309 0.25
310 0.26
311 0.3
312 0.33
313 0.36
314 0.39
315 0.39
316 0.45
317 0.46
318 0.49
319 0.49
320 0.46
321 0.43
322 0.38
323 0.38
324 0.37
325 0.37
326 0.37
327 0.37
328 0.38
329 0.37
330 0.41
331 0.42
332 0.46
333 0.5