Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2X9Y9

Protein Details
Accession A0A0D2X9Y9    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
20-49MRNSENPRSREERRRRSRKKEVQNEQQNGGHydrophilic
NLS Segment(s)
PositionSequence
27-39RSREERRRRSRKK
Subcellular Location(s) nucl 6mito 6mito_nucl 6, cyto 5, plas 5
Family & Domain DBs
KEGG fox:FOXG_00704  -  
Amino Acid Sequences MVDRGEAATVAQWERQYVAMRNSENPRSREERRRRSRKKEVQNEQQNGGRLMVIAKVEVAVVVLVVDKAQAGRGRGAIYARLRRGLQEGETARGTVGGSLAFDAAGSCVENLPTTSWCRA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.15
2 0.18
3 0.2
4 0.22
5 0.26
6 0.3
7 0.31
8 0.37
9 0.42
10 0.48
11 0.5
12 0.48
13 0.49
14 0.5
15 0.56
16 0.6
17 0.65
18 0.68
19 0.72
20 0.82
21 0.86
22 0.89
23 0.93
24 0.93
25 0.93
26 0.92
27 0.91
28 0.91
29 0.91
30 0.84
31 0.76
32 0.68
33 0.59
34 0.49
35 0.39
36 0.27
37 0.17
38 0.14
39 0.12
40 0.08
41 0.06
42 0.05
43 0.05
44 0.05
45 0.05
46 0.04
47 0.02
48 0.02
49 0.02
50 0.02
51 0.02
52 0.02
53 0.02
54 0.02
55 0.03
56 0.05
57 0.07
58 0.08
59 0.09
60 0.1
61 0.11
62 0.12
63 0.13
64 0.16
65 0.21
66 0.26
67 0.26
68 0.29
69 0.28
70 0.28
71 0.31
72 0.28
73 0.23
74 0.25
75 0.25
76 0.26
77 0.26
78 0.25
79 0.21
80 0.2
81 0.18
82 0.1
83 0.09
84 0.06
85 0.06
86 0.06
87 0.06
88 0.05
89 0.05
90 0.05
91 0.05
92 0.05
93 0.05
94 0.06
95 0.06
96 0.07
97 0.08
98 0.09
99 0.11
100 0.13