Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XAD2

Protein Details
Accession A0A0D2XAD2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
95-120PITLENMPRPHRRRREKKLMTMDEVNHydrophilic
NLS Segment(s)
PositionSequence
103-112RPHRRRREKK
Subcellular Location(s) cyto 7.5cyto_nucl 7.5, extr 7, nucl 6.5, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR001841  Znf_RING  
IPR013083  Znf_RING/FYVE/PHD  
Gene Ontology GO:0016020  C:membrane  
KEGG fox:FOXG_00847  -  
Pfam View protein in Pfam  
PF13639  zf-RING_2  
PROSITE View protein in PROSITE  
PS50089  ZF_RING_2  
CDD cd16473  RING-H2_RNF103  
Amino Acid Sequences MVAVNQILTEVTHVVIRAAAAEDPSSTTSHAAAETTDSGNEKKDNGGGSNSPLLFFVALGFGVVFTNLWIIVGVKYCFRYNARNRQMRMNEDGEPITLENMPRPHRRRREKKLMTMDEVNDKFPMMKYKTWVSDRAKEGLPTTGGVSAPPTRPNSIREADGIVPDFSAKVRDSTDEQPATTVPKTNGQGETTGASNATETSAPEIAATAVVPETEKPKETPKTTEGQTSTEQTANNNRLQRISSEETDDEDDHIDGALPPECLENPGDTCAICIDTLEDDDDVRGLTCGHAFHAVCVDPWLTSRRACCPLCKADYYVPKPRPAPDAANEAGANNGSSFDPRNNPRFGLPAAIRSAWIRGPRNGRNETPAPASRRRRTGDAAAEQEPVQQPEQAHQTPEVTQTSNGGVLSSVRGALRFGRRRQAQDNQNGSETVTPSQLEAANRTPAAT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.09
2 0.1
3 0.09
4 0.09
5 0.1
6 0.1
7 0.1
8 0.1
9 0.11
10 0.12
11 0.14
12 0.14
13 0.13
14 0.13
15 0.13
16 0.14
17 0.14
18 0.12
19 0.11
20 0.13
21 0.15
22 0.15
23 0.16
24 0.16
25 0.17
26 0.2
27 0.21
28 0.19
29 0.19
30 0.21
31 0.22
32 0.22
33 0.26
34 0.24
35 0.27
36 0.32
37 0.3
38 0.27
39 0.25
40 0.23
41 0.19
42 0.17
43 0.13
44 0.07
45 0.07
46 0.06
47 0.06
48 0.05
49 0.05
50 0.05
51 0.05
52 0.04
53 0.05
54 0.05
55 0.05
56 0.05
57 0.06
58 0.07
59 0.11
60 0.11
61 0.13
62 0.16
63 0.17
64 0.21
65 0.23
66 0.32
67 0.39
68 0.5
69 0.57
70 0.63
71 0.65
72 0.71
73 0.74
74 0.69
75 0.65
76 0.58
77 0.5
78 0.45
79 0.43
80 0.33
81 0.28
82 0.23
83 0.18
84 0.16
85 0.13
86 0.14
87 0.19
88 0.25
89 0.33
90 0.39
91 0.48
92 0.58
93 0.69
94 0.76
95 0.81
96 0.87
97 0.86
98 0.91
99 0.91
100 0.87
101 0.82
102 0.76
103 0.68
104 0.65
105 0.57
106 0.47
107 0.36
108 0.3
109 0.25
110 0.21
111 0.27
112 0.21
113 0.22
114 0.25
115 0.31
116 0.37
117 0.4
118 0.47
119 0.45
120 0.49
121 0.5
122 0.5
123 0.46
124 0.4
125 0.38
126 0.32
127 0.27
128 0.19
129 0.17
130 0.15
131 0.13
132 0.12
133 0.13
134 0.14
135 0.15
136 0.19
137 0.21
138 0.22
139 0.24
140 0.27
141 0.3
142 0.28
143 0.28
144 0.25
145 0.26
146 0.24
147 0.23
148 0.22
149 0.16
150 0.14
151 0.12
152 0.11
153 0.08
154 0.1
155 0.08
156 0.09
157 0.09
158 0.12
159 0.16
160 0.19
161 0.26
162 0.25
163 0.24
164 0.24
165 0.23
166 0.25
167 0.21
168 0.2
169 0.14
170 0.19
171 0.2
172 0.23
173 0.24
174 0.22
175 0.22
176 0.19
177 0.19
178 0.14
179 0.13
180 0.09
181 0.08
182 0.07
183 0.06
184 0.06
185 0.05
186 0.05
187 0.07
188 0.07
189 0.07
190 0.07
191 0.07
192 0.06
193 0.06
194 0.06
195 0.04
196 0.03
197 0.03
198 0.04
199 0.04
200 0.07
201 0.08
202 0.09
203 0.1
204 0.17
205 0.23
206 0.25
207 0.29
208 0.29
209 0.33
210 0.33
211 0.37
212 0.32
213 0.3
214 0.29
215 0.27
216 0.26
217 0.23
218 0.22
219 0.18
220 0.23
221 0.24
222 0.26
223 0.27
224 0.25
225 0.25
226 0.25
227 0.24
228 0.24
229 0.25
230 0.22
231 0.22
232 0.21
233 0.22
234 0.23
235 0.22
236 0.16
237 0.13
238 0.12
239 0.09
240 0.09
241 0.07
242 0.05
243 0.06
244 0.07
245 0.06
246 0.06
247 0.07
248 0.07
249 0.08
250 0.08
251 0.08
252 0.08
253 0.09
254 0.1
255 0.09
256 0.09
257 0.08
258 0.08
259 0.07
260 0.06
261 0.05
262 0.05
263 0.06
264 0.07
265 0.06
266 0.06
267 0.06
268 0.06
269 0.05
270 0.05
271 0.05
272 0.04
273 0.04
274 0.06
275 0.06
276 0.07
277 0.11
278 0.11
279 0.11
280 0.13
281 0.13
282 0.12
283 0.13
284 0.13
285 0.08
286 0.1
287 0.13
288 0.13
289 0.14
290 0.17
291 0.21
292 0.29
293 0.3
294 0.33
295 0.37
296 0.42
297 0.44
298 0.44
299 0.42
300 0.41
301 0.5
302 0.52
303 0.55
304 0.52
305 0.53
306 0.53
307 0.52
308 0.5
309 0.45
310 0.43
311 0.37
312 0.4
313 0.35
314 0.35
315 0.33
316 0.27
317 0.24
318 0.19
319 0.15
320 0.08
321 0.09
322 0.06
323 0.08
324 0.1
325 0.12
326 0.2
327 0.26
328 0.31
329 0.33
330 0.34
331 0.34
332 0.36
333 0.33
334 0.33
335 0.29
336 0.28
337 0.28
338 0.27
339 0.27
340 0.24
341 0.25
342 0.21
343 0.28
344 0.27
345 0.3
346 0.39
347 0.45
348 0.53
349 0.57
350 0.55
351 0.55
352 0.55
353 0.52
354 0.5
355 0.49
356 0.47
357 0.52
358 0.59
359 0.59
360 0.64
361 0.65
362 0.63
363 0.63
364 0.64
365 0.64
366 0.62
367 0.6
368 0.53
369 0.51
370 0.45
371 0.44
372 0.38
373 0.31
374 0.24
375 0.22
376 0.2
377 0.23
378 0.31
379 0.28
380 0.28
381 0.27
382 0.28
383 0.27
384 0.32
385 0.3
386 0.24
387 0.22
388 0.22
389 0.22
390 0.22
391 0.19
392 0.15
393 0.12
394 0.11
395 0.13
396 0.12
397 0.12
398 0.11
399 0.11
400 0.12
401 0.19
402 0.29
403 0.36
404 0.41
405 0.49
406 0.56
407 0.63
408 0.7
409 0.73
410 0.72
411 0.74
412 0.77
413 0.71
414 0.66
415 0.59
416 0.52
417 0.46
418 0.38
419 0.29
420 0.23
421 0.19
422 0.17
423 0.2
424 0.23
425 0.21
426 0.23
427 0.26
428 0.29