Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0D2XVH2

Protein Details
Accession A0A0D2XVH2    Localization Confidence Medium Confidence Score 10.1
NoLS Segment(s)
PositionSequenceProtein Nature
81-104EELKLRGKSAPKKKKGPPGFSHDSBasic
NLS Segment(s)
PositionSequence
85-98LRGKSAPKKKKGPP
Subcellular Location(s) mito 16.5, cyto_mito 10.5, nucl 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR013219  Ribosomal_S27/S33_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08293  MRP-S33  
Amino Acid Sequences MSVPRARILDLVKAQCQVFATSYNPEGVRMGNKVLRQRLRGPAMAAYYPRKTATIKDLKREFGPTLATWDEGEEDRFEYIEELKLRGKSAPKKKKGPPGFSHDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.36
2 0.33
3 0.32
4 0.25
5 0.19
6 0.17
7 0.17
8 0.18
9 0.19
10 0.2
11 0.19
12 0.18
13 0.17
14 0.16
15 0.17
16 0.15
17 0.17
18 0.18
19 0.21
20 0.26
21 0.33
22 0.37
23 0.38
24 0.42
25 0.46
26 0.47
27 0.45
28 0.4
29 0.34
30 0.32
31 0.29
32 0.26
33 0.22
34 0.19
35 0.19
36 0.18
37 0.17
38 0.16
39 0.16
40 0.23
41 0.3
42 0.31
43 0.39
44 0.41
45 0.42
46 0.42
47 0.44
48 0.35
49 0.26
50 0.27
51 0.18
52 0.2
53 0.18
54 0.18
55 0.15
56 0.14
57 0.14
58 0.12
59 0.13
60 0.09
61 0.09
62 0.09
63 0.09
64 0.09
65 0.08
66 0.09
67 0.13
68 0.14
69 0.15
70 0.19
71 0.2
72 0.21
73 0.24
74 0.32
75 0.37
76 0.47
77 0.56
78 0.62
79 0.71
80 0.78
81 0.85
82 0.87
83 0.87
84 0.83