Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2YCR6

Protein Details
Accession A0A0D2YCR6    Localization Confidence Medium Confidence Score 11.6
NoLS Segment(s)
PositionSequenceProtein Nature
66-116FAQPQRPKTRRYKLKQPKPHHTNPQSRPKPKPEPKSHHKKHKLIPHQPEFABasic
120-141KRNAHGTNYKPHRRWHRHANSQBasic
NLS Segment(s)
PositionSequence
71-122RPKTRRYKLKQPKPHHTNPQSRPKPKPEPKSHHKKHKLIPHQPEFAGPQKRN
Subcellular Location(s) extr 11, mito 6, nucl 4, plas 4
Family & Domain DBs
KEGG fox:FOXG_14098  -  
Amino Acid Sequences MKLSAAVLIIFATGILAAPIAMAGGDATPASYNSPEEVKSYDRPKPETHFRPYYTKLKPKLYQPVFAQPQRPKTRRYKLKQPKPHHTNPQSRPKPKPEPKSHHKKHKLIPHQPEFAGPQKRNAHGTNYKPHRRWHRHANSQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.02
9 0.02
10 0.03
11 0.03
12 0.03
13 0.03
14 0.04
15 0.04
16 0.05
17 0.06
18 0.07
19 0.08
20 0.09
21 0.11
22 0.11
23 0.13
24 0.15
25 0.17
26 0.23
27 0.28
28 0.31
29 0.34
30 0.37
31 0.39
32 0.44
33 0.5
34 0.51
35 0.53
36 0.55
37 0.54
38 0.58
39 0.59
40 0.61
41 0.59
42 0.6
43 0.59
44 0.6
45 0.6
46 0.59
47 0.64
48 0.58
49 0.55
50 0.49
51 0.52
52 0.5
53 0.49
54 0.5
55 0.43
56 0.5
57 0.54
58 0.54
59 0.51
60 0.55
61 0.64
62 0.67
63 0.7
64 0.72
65 0.74
66 0.83
67 0.87
68 0.86
69 0.86
70 0.85
71 0.86
72 0.85
73 0.84
74 0.83
75 0.81
76 0.84
77 0.82
78 0.8
79 0.79
80 0.77
81 0.79
82 0.78
83 0.8
84 0.8
85 0.8
86 0.84
87 0.88
88 0.89
89 0.89
90 0.9
91 0.88
92 0.85
93 0.86
94 0.86
95 0.85
96 0.86
97 0.82
98 0.77
99 0.68
100 0.63
101 0.57
102 0.54
103 0.54
104 0.44
105 0.45
106 0.46
107 0.49
108 0.52
109 0.5
110 0.51
111 0.5
112 0.57
113 0.58
114 0.63
115 0.7
116 0.68
117 0.76
118 0.78
119 0.79
120 0.81
121 0.81