Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S5X0

Protein Details
Accession E3S5X0   
Localization Confidence Medium
Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
41-62DVRSSKRPRSRTPVIKKSRSATHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
KEGG pte:PTT_18080  -  
Amino Acid Sequences MPTVEDQPYRRNTAPEGWQPRDHITKMVKDRISSTPDLEDDVRSSKRPRSRTPVIKKSRSATLTIEPTSEE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.49
3 0.52
4 0.5
5 0.52
6 0.52
7 0.53
8 0.52
9 0.45
10 0.41
11 0.35
12 0.38
13 0.41
14 0.46
15 0.42
16 0.38
17 0.41
18 0.39
19 0.4
20 0.33
21 0.28
22 0.22
23 0.21
24 0.22
25 0.19
26 0.15
27 0.12
28 0.15
29 0.15
30 0.16
31 0.19
32 0.24
33 0.31
34 0.37
35 0.43
36 0.48
37 0.58
38 0.66
39 0.74
40 0.78
41 0.81
42 0.82
43 0.8
44 0.75
45 0.74
46 0.65
47 0.57
48 0.51
49 0.49
50 0.48
51 0.43