Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2XEV1

Protein Details
Accession A0A0D2XEV1    Localization Confidence Medium Confidence Score 11.2
NoLS Segment(s)
PositionSequenceProtein Nature
86-113MAKLANKKAKKANKKKNNKTKESKEDLLHydrophilic
NLS Segment(s)
PositionSequence
89-147LANKKAKKANKKKNNKTKESKEDLLKEKAELTKEKVGLTKERAALVKALKVKKAEKIRA
Subcellular Location(s) cyto_nucl 14.5, nucl 12.5, cyto 11.5
Family & Domain DBs
Amino Acid Sequences MHEPTIQIITRPPEPLDAEPKPEPQVIWRDENGKIYFRNNPTLPILRYPNTNEEIEKEIRELELDVEKDFEVPEAKKPEPNIDIEMAKLANKKAKKANKKKNNKTKESKEDLLKEKAELTKEKVGLTKERAALVKALKVKKAEKIRAETPAKTTAKTIAEMKKLSEFISVRIKRYNRHDAPLSEKMAEEDLKYTIEKMYKHLPNSFVDWEYEEDVDVCRILDLPCYGKSFGKDIEDHLYGKEHLAYDRSMKGSVPLCVQHNRVKREIENGLSYHEGLLAELSVDPYSY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.35
3 0.39
4 0.37
5 0.4
6 0.41
7 0.43
8 0.42
9 0.4
10 0.35
11 0.32
12 0.39
13 0.37
14 0.4
15 0.39
16 0.39
17 0.4
18 0.47
19 0.43
20 0.38
21 0.36
22 0.34
23 0.4
24 0.4
25 0.46
26 0.4
27 0.41
28 0.43
29 0.47
30 0.46
31 0.43
32 0.45
33 0.38
34 0.42
35 0.42
36 0.43
37 0.4
38 0.39
39 0.33
40 0.3
41 0.34
42 0.32
43 0.28
44 0.22
45 0.19
46 0.18
47 0.18
48 0.15
49 0.12
50 0.14
51 0.14
52 0.14
53 0.14
54 0.14
55 0.14
56 0.13
57 0.12
58 0.11
59 0.12
60 0.18
61 0.22
62 0.24
63 0.26
64 0.27
65 0.33
66 0.31
67 0.33
68 0.3
69 0.27
70 0.26
71 0.23
72 0.23
73 0.17
74 0.17
75 0.17
76 0.16
77 0.19
78 0.2
79 0.26
80 0.33
81 0.43
82 0.52
83 0.61
84 0.71
85 0.75
86 0.85
87 0.91
88 0.93
89 0.93
90 0.92
91 0.91
92 0.9
93 0.89
94 0.85
95 0.8
96 0.75
97 0.72
98 0.67
99 0.62
100 0.52
101 0.43
102 0.38
103 0.35
104 0.32
105 0.27
106 0.26
107 0.27
108 0.27
109 0.28
110 0.27
111 0.27
112 0.28
113 0.3
114 0.3
115 0.26
116 0.27
117 0.27
118 0.24
119 0.25
120 0.22
121 0.22
122 0.23
123 0.23
124 0.23
125 0.26
126 0.28
127 0.31
128 0.38
129 0.41
130 0.39
131 0.43
132 0.43
133 0.49
134 0.5
135 0.44
136 0.39
137 0.42
138 0.38
139 0.33
140 0.31
141 0.27
142 0.25
143 0.25
144 0.28
145 0.24
146 0.28
147 0.28
148 0.28
149 0.26
150 0.26
151 0.24
152 0.24
153 0.19
154 0.18
155 0.28
156 0.29
157 0.28
158 0.34
159 0.35
160 0.36
161 0.44
162 0.51
163 0.44
164 0.47
165 0.5
166 0.46
167 0.52
168 0.52
169 0.47
170 0.36
171 0.33
172 0.29
173 0.26
174 0.24
175 0.16
176 0.12
177 0.1
178 0.11
179 0.11
180 0.11
181 0.11
182 0.14
183 0.14
184 0.17
185 0.25
186 0.29
187 0.32
188 0.35
189 0.35
190 0.34
191 0.38
192 0.37
193 0.29
194 0.25
195 0.24
196 0.22
197 0.2
198 0.18
199 0.14
200 0.12
201 0.11
202 0.11
203 0.09
204 0.07
205 0.06
206 0.07
207 0.07
208 0.09
209 0.1
210 0.13
211 0.15
212 0.18
213 0.2
214 0.21
215 0.22
216 0.23
217 0.24
218 0.25
219 0.24
220 0.24
221 0.29
222 0.29
223 0.27
224 0.25
225 0.25
226 0.21
227 0.21
228 0.21
229 0.16
230 0.15
231 0.17
232 0.17
233 0.19
234 0.23
235 0.24
236 0.22
237 0.21
238 0.25
239 0.26
240 0.26
241 0.26
242 0.26
243 0.29
244 0.33
245 0.38
246 0.42
247 0.47
248 0.5
249 0.52
250 0.54
251 0.51
252 0.54
253 0.55
254 0.51
255 0.48
256 0.43
257 0.42
258 0.38
259 0.36
260 0.28
261 0.23
262 0.18
263 0.13
264 0.13
265 0.09
266 0.08
267 0.08
268 0.09