Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0D2Y1J1

Protein Details
Accession A0A0D2Y1J1    Localization Confidence Low Confidence Score 9.5
NoLS Segment(s)
PositionSequenceProtein Nature
90-109MLFIRRRKKRERNAISAPGEHydrophilic
NLS Segment(s)
PositionSequence
94-101RRRKKRER
Subcellular Location(s) mito 10, plas 5, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR019931  LPXTG_anchor  
Gene Ontology GO:0016020  C:membrane  
Pfam View protein in Pfam  
PF00746  Gram_pos_anchor  
Amino Acid Sequences MKCTYGASSRCLYFIYQTASDDNAKLTSWGCGETPTTYIVGPLQAEHTASATAPTNDETDSSSGLSKDATIALAVILPVVGLAILVAAAMLFIRRRKKRERNAISAPGEGARSEMEQTTECAPVSAVPPYEMGDNVLRPELDSHEVRYGTN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.24
2 0.25
3 0.22
4 0.23
5 0.24
6 0.25
7 0.26
8 0.23
9 0.2
10 0.15
11 0.14
12 0.14
13 0.12
14 0.12
15 0.11
16 0.12
17 0.11
18 0.12
19 0.13
20 0.13
21 0.14
22 0.13
23 0.13
24 0.11
25 0.11
26 0.1
27 0.1
28 0.09
29 0.08
30 0.09
31 0.09
32 0.09
33 0.09
34 0.09
35 0.08
36 0.08
37 0.09
38 0.08
39 0.08
40 0.09
41 0.09
42 0.1
43 0.09
44 0.1
45 0.1
46 0.09
47 0.1
48 0.1
49 0.09
50 0.08
51 0.08
52 0.08
53 0.06
54 0.06
55 0.06
56 0.05
57 0.04
58 0.04
59 0.04
60 0.04
61 0.04
62 0.03
63 0.03
64 0.02
65 0.02
66 0.02
67 0.02
68 0.01
69 0.01
70 0.01
71 0.01
72 0.01
73 0.01
74 0.01
75 0.01
76 0.01
77 0.02
78 0.04
79 0.08
80 0.18
81 0.23
82 0.3
83 0.41
84 0.51
85 0.62
86 0.72
87 0.76
88 0.76
89 0.8
90 0.83
91 0.74
92 0.64
93 0.55
94 0.44
95 0.36
96 0.27
97 0.19
98 0.11
99 0.09
100 0.1
101 0.09
102 0.1
103 0.1
104 0.12
105 0.14
106 0.14
107 0.13
108 0.12
109 0.12
110 0.12
111 0.13
112 0.14
113 0.12
114 0.12
115 0.13
116 0.14
117 0.15
118 0.13
119 0.15
120 0.14
121 0.15
122 0.16
123 0.17
124 0.16
125 0.15
126 0.17
127 0.18
128 0.21
129 0.21
130 0.24
131 0.28