Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M743

Protein Details
Accession W7M743   
Localization Confidence Medium
Confidence Score 14.5
NoLS Segment(s)
PositionSequenceProtein Nature
7-32ELMKWMSRFKWRKHHRKIRLEENDAVHydrophilic
NLS Segment(s)
PositionSequence
19-19K
Subcellular Location(s) nucl 24.5, cyto_nucl 13
Family & Domain DBs
KEGG fvr:FVEG_15553  -  
Amino Acid Sequences MGTEWDELMKWMSRFKWRKHHRKIRLEENDAVDDVKRKPDDKTQPQCEIGPEITMIVRTNDNQQIESQV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.47
3 0.55
4 0.62
5 0.73
6 0.8
7 0.87
8 0.87
9 0.9
10 0.9
11 0.9
12 0.89
13 0.83
14 0.76
15 0.68
16 0.58
17 0.48
18 0.4
19 0.29
20 0.22
21 0.17
22 0.17
23 0.15
24 0.15
25 0.17
26 0.26
27 0.36
28 0.44
29 0.54
30 0.56
31 0.6
32 0.61
33 0.6
34 0.52
35 0.46
36 0.35
37 0.26
38 0.19
39 0.15
40 0.13
41 0.13
42 0.12
43 0.1
44 0.12
45 0.12
46 0.18
47 0.24
48 0.25
49 0.25