Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7LW50

Protein Details
Accession W7LW50    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
83-103AGSAKKRATPRKAKKEESEDDBasic
NLS Segment(s)
PositionSequence
74-98PKRKAKSEGAGSAKKRATPRKAKKE
Subcellular Location(s) nucl 18, cyto 9, mito_nucl 9
Family & Domain DBs
KEGG fvr:FVEG_04917  -  
Amino Acid Sequences MSKQEPADQVKFLVSCIGHTSNGRPDFQAVADELAIVSKAAAQKRYERMLKAHGISRPGALANGNGVDSAPSTPKRKAKSEGAGSAKKRATPRKAKKEESEDDEDVKPKTPASKSKVKKEEEKDSADSTGSLSDAPPSDS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.16
3 0.2
4 0.21
5 0.2
6 0.21
7 0.25
8 0.29
9 0.32
10 0.32
11 0.28
12 0.27
13 0.26
14 0.25
15 0.23
16 0.15
17 0.13
18 0.12
19 0.11
20 0.09
21 0.08
22 0.07
23 0.05
24 0.04
25 0.05
26 0.09
27 0.12
28 0.15
29 0.17
30 0.24
31 0.29
32 0.36
33 0.37
34 0.36
35 0.37
36 0.39
37 0.42
38 0.38
39 0.37
40 0.32
41 0.31
42 0.29
43 0.26
44 0.21
45 0.16
46 0.15
47 0.1
48 0.08
49 0.07
50 0.07
51 0.06
52 0.05
53 0.05
54 0.05
55 0.05
56 0.05
57 0.07
58 0.1
59 0.13
60 0.17
61 0.23
62 0.27
63 0.31
64 0.36
65 0.41
66 0.46
67 0.49
68 0.52
69 0.53
70 0.56
71 0.53
72 0.54
73 0.48
74 0.44
75 0.45
76 0.46
77 0.49
78 0.54
79 0.64
80 0.68
81 0.76
82 0.79
83 0.8
84 0.8
85 0.77
86 0.73
87 0.69
88 0.6
89 0.55
90 0.5
91 0.44
92 0.36
93 0.31
94 0.25
95 0.18
96 0.23
97 0.25
98 0.32
99 0.36
100 0.46
101 0.52
102 0.62
103 0.7
104 0.7
105 0.74
106 0.73
107 0.78
108 0.74
109 0.73
110 0.66
111 0.6
112 0.55
113 0.46
114 0.38
115 0.28
116 0.22
117 0.16
118 0.12
119 0.09
120 0.11