Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7LJH4

Protein Details
Accession W7LJH4   
Localization Confidence Low
Confidence Score 9.2
NoLS Segment(s)
PositionSequenceProtein Nature
76-103REHSASRTGRTRERKKKKTDSIALQLPEHydrophilic
NLS Segment(s)
PositionSequence
82-93RTGRTRERKKKK
Subcellular Location(s) mito 20, nucl 3, pero 2
Family & Domain DBs
KEGG fvr:FVEG_14934  -  
Amino Acid Sequences MVLGNKFSRFPLPLQQPSQPYCGRYNNKAVFFSVFFFSLCLPHRLLQKTVPVARVRAVDGDAPSRGPFVKTGRYQREHSASRTGRTRERKKKKTDSIALQLPET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.47
2 0.51
3 0.53
4 0.53
5 0.56
6 0.48
7 0.43
8 0.41
9 0.46
10 0.46
11 0.46
12 0.53
13 0.53
14 0.54
15 0.52
16 0.47
17 0.4
18 0.35
19 0.32
20 0.23
21 0.17
22 0.14
23 0.13
24 0.12
25 0.13
26 0.13
27 0.13
28 0.14
29 0.16
30 0.22
31 0.24
32 0.25
33 0.24
34 0.27
35 0.3
36 0.31
37 0.32
38 0.27
39 0.26
40 0.26
41 0.25
42 0.21
43 0.16
44 0.15
45 0.12
46 0.12
47 0.13
48 0.12
49 0.11
50 0.11
51 0.11
52 0.1
53 0.09
54 0.12
55 0.13
56 0.21
57 0.26
58 0.36
59 0.44
60 0.48
61 0.51
62 0.55
63 0.6
64 0.56
65 0.53
66 0.54
67 0.48
68 0.49
69 0.53
70 0.51
71 0.52
72 0.59
73 0.67
74 0.68
75 0.77
76 0.81
77 0.84
78 0.91
79 0.92
80 0.92
81 0.91
82 0.89
83 0.87
84 0.86