Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3RVN8

Protein Details
Accession E3RVN8   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
85-108HEFLPVRKTSRTRRKLSKRHRRPTBasic
NLS Segment(s)
PositionSequence
91-108RKTSRTRRKLSKRHRRPT
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 4
Family & Domain DBs
KEGG pte:PTT_13263  -  
Amino Acid Sequences MPRFFRRFFNEISFRKEQDVSDVQRSRRVLRRNPAGDLDEQHTPWRSSFFDAHIQGEENRALRDGTSVADSDAQAAEQPIVAPNHEFLPVRKTSRTRRKLSKRHRRPT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.51
2 0.51
3 0.48
4 0.39
5 0.36
6 0.4
7 0.37
8 0.42
9 0.46
10 0.43
11 0.47
12 0.49
13 0.48
14 0.48
15 0.52
16 0.5
17 0.54
18 0.64
19 0.61
20 0.62
21 0.59
22 0.54
23 0.47
24 0.41
25 0.34
26 0.26
27 0.23
28 0.22
29 0.2
30 0.18
31 0.17
32 0.17
33 0.15
34 0.16
35 0.17
36 0.18
37 0.22
38 0.22
39 0.23
40 0.21
41 0.21
42 0.18
43 0.18
44 0.17
45 0.11
46 0.1
47 0.1
48 0.09
49 0.08
50 0.09
51 0.08
52 0.07
53 0.08
54 0.08
55 0.07
56 0.09
57 0.09
58 0.08
59 0.08
60 0.07
61 0.06
62 0.06
63 0.06
64 0.05
65 0.05
66 0.08
67 0.08
68 0.09
69 0.09
70 0.1
71 0.11
72 0.14
73 0.14
74 0.13
75 0.18
76 0.23
77 0.27
78 0.32
79 0.38
80 0.47
81 0.58
82 0.66
83 0.7
84 0.76
85 0.83
86 0.88
87 0.92
88 0.92