Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M3Y1

Protein Details
Accession W7M3Y1   
Localization Confidence Low
Confidence Score 6
NoLS Segment(s)
PositionSequenceProtein Nature
55-77QLAKRGRRAPQKQQQWHKRVPKIHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 9.5, mito 8, cyto_nucl 7, nucl 3.5, pero 2, plas 1, extr 1, cysk 1, vacu 1
Family & Domain DBs
KEGG fvr:FVEG_04140  -  
Amino Acid Sequences MSSAETKIKRVGDGKKEDGEERQARECFETSAVLVLVLVLVLRYQPGTCLGFHFQLAKRGRRAPQKQQQWHKRVPKIEWATGPFLVSSPGASGLDWAEVPEKEVCE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.55
3 0.56
4 0.53
5 0.5
6 0.5
7 0.45
8 0.41
9 0.42
10 0.38
11 0.37
12 0.38
13 0.35
14 0.27
15 0.23
16 0.2
17 0.14
18 0.14
19 0.12
20 0.09
21 0.08
22 0.06
23 0.05
24 0.04
25 0.03
26 0.02
27 0.02
28 0.02
29 0.02
30 0.03
31 0.03
32 0.04
33 0.07
34 0.08
35 0.08
36 0.11
37 0.13
38 0.13
39 0.13
40 0.17
41 0.15
42 0.22
43 0.27
44 0.28
45 0.3
46 0.35
47 0.4
48 0.47
49 0.54
50 0.56
51 0.62
52 0.68
53 0.74
54 0.8
55 0.84
56 0.82
57 0.84
58 0.83
59 0.8
60 0.75
61 0.69
62 0.68
63 0.64
64 0.61
65 0.56
66 0.5
67 0.47
68 0.42
69 0.39
70 0.28
71 0.22
72 0.19
73 0.14
74 0.11
75 0.08
76 0.09
77 0.09
78 0.09
79 0.1
80 0.09
81 0.1
82 0.1
83 0.1
84 0.11
85 0.11
86 0.14