Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MUW5

Protein Details
Accession W7MUW5    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
11-36ILACVLCHQRKKKCDRKRPCSFCTKAHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR036864  Zn2-C6_fun-type_DNA-bd_sf  
IPR001138  Zn2Cys6_DnaBD  
Gene Ontology GO:0005634  C:nucleus  
GO:0000981  F:DNA-binding transcription factor activity, RNA polymerase II-specific  
GO:0008270  F:zinc ion binding  
KEGG fvr:FVEG_10488  -  
Pfam View protein in Pfam  
PF00172  Zn_clus  
PROSITE View protein in PROSITE  
PS00463  ZN2_CY6_FUNGAL_1  
PS50048  ZN2_CY6_FUNGAL_2  
CDD cd00067  GAL4  
Amino Acid Sequences MAPEKQRSPRILACVLCHQRKKKCDRKRPCSFCTKAGIECIPSTPAPKRSHRKPVKEILARLDRCEELLKKCNCVQKPWKYVSPKMGNIMVD
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.55
3 0.56
4 0.59
5 0.61
6 0.63
7 0.7
8 0.77
9 0.77
10 0.8
11 0.82
12 0.86
13 0.88
14 0.91
15 0.91
16 0.86
17 0.86
18 0.78
19 0.72
20 0.68
21 0.59
22 0.49
23 0.43
24 0.38
25 0.29
26 0.26
27 0.22
28 0.17
29 0.14
30 0.15
31 0.16
32 0.22
33 0.25
34 0.34
35 0.41
36 0.47
37 0.58
38 0.64
39 0.69
40 0.69
41 0.74
42 0.75
43 0.73
44 0.68
45 0.65
46 0.65
47 0.57
48 0.52
49 0.45
50 0.35
51 0.3
52 0.33
53 0.29
54 0.25
55 0.34
56 0.34
57 0.36
58 0.41
59 0.47
60 0.45
61 0.51
62 0.55
63 0.56
64 0.63
65 0.65
66 0.69
67 0.68
68 0.73
69 0.74
70 0.73
71 0.67
72 0.63