Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7ML02

Protein Details
Accession W7ML02   
Localization Confidence Medium
Confidence Score 13.9
NoLS Segment(s)
PositionSequenceProtein Nature
181-211AAIKQAGKEKKKHKKQEKRLQKREKAADKFDBasic
283-313MEKHGKAITKVNKKAKKKDEKDEKKVAKLEWBasic
NLS Segment(s)
PositionSequence
183-206IKQAGKEKKKHKKQEKRLQKREKA
264-308IEKRRRKDLEEVEKDRVRLMEKHGKAITKVNKKAKKKDEKDEKKV
Subcellular Location(s) mito 13.5, cyto_mito 9.833, nucl 8.5, cyto_nucl 7.333, cyto 5
Family & Domain DBs
KEGG fvr:FVEG_10931  -  
Amino Acid Sequences MERPTLSPSRPILIPSTSITGSLEVTPPYHRAYPPILNSYEISSKEFMAIIDALNIALAEPAPFKAMEVAGDGLGFVPNEIAQGVSLGLGLAAGTGTAATAYFRERKVLERVNRDIFAPKGLVMKTMKDEEVMQRLNTTAKSLDPLLRLQEISSHVEVLSFDVEPPVRHSNMLDRISAKQAAIKQAGKEKKKHKKQEKRLQKREKAADKFDRSVDSVDEQYNSDVESRIEIEAKIARLEDRIAEINIKAEEKLMESSEKKVGEIEKRRRKDLEEVEKDRVRLMEKHGKAITKVNKKAKKKDEKDEKKVAKLEWIMIRTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.27
3 0.29
4 0.24
5 0.24
6 0.23
7 0.2
8 0.18
9 0.17
10 0.17
11 0.13
12 0.14
13 0.16
14 0.18
15 0.21
16 0.24
17 0.23
18 0.25
19 0.31
20 0.37
21 0.4
22 0.44
23 0.41
24 0.39
25 0.4
26 0.39
27 0.38
28 0.31
29 0.29
30 0.24
31 0.23
32 0.22
33 0.21
34 0.17
35 0.14
36 0.13
37 0.1
38 0.1
39 0.1
40 0.08
41 0.08
42 0.08
43 0.05
44 0.05
45 0.04
46 0.04
47 0.05
48 0.06
49 0.07
50 0.07
51 0.07
52 0.09
53 0.09
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.07
61 0.08
62 0.07
63 0.05
64 0.04
65 0.04
66 0.05
67 0.05
68 0.04
69 0.04
70 0.04
71 0.04
72 0.04
73 0.04
74 0.03
75 0.03
76 0.03
77 0.03
78 0.02
79 0.02
80 0.02
81 0.02
82 0.02
83 0.02
84 0.02
85 0.02
86 0.03
87 0.04
88 0.07
89 0.11
90 0.11
91 0.14
92 0.15
93 0.2
94 0.27
95 0.35
96 0.4
97 0.44
98 0.49
99 0.51
100 0.5
101 0.47
102 0.42
103 0.34
104 0.29
105 0.22
106 0.17
107 0.16
108 0.15
109 0.18
110 0.16
111 0.17
112 0.18
113 0.2
114 0.19
115 0.16
116 0.17
117 0.16
118 0.21
119 0.21
120 0.18
121 0.16
122 0.17
123 0.18
124 0.16
125 0.15
126 0.09
127 0.08
128 0.1
129 0.11
130 0.13
131 0.13
132 0.14
133 0.14
134 0.15
135 0.14
136 0.13
137 0.14
138 0.14
139 0.16
140 0.15
141 0.13
142 0.12
143 0.12
144 0.12
145 0.1
146 0.09
147 0.06
148 0.05
149 0.06
150 0.07
151 0.06
152 0.11
153 0.13
154 0.13
155 0.13
156 0.13
157 0.18
158 0.26
159 0.27
160 0.24
161 0.23
162 0.24
163 0.26
164 0.27
165 0.21
166 0.16
167 0.16
168 0.2
169 0.22
170 0.22
171 0.22
172 0.29
173 0.37
174 0.39
175 0.45
176 0.51
177 0.58
178 0.67
179 0.76
180 0.79
181 0.82
182 0.89
183 0.92
184 0.93
185 0.94
186 0.95
187 0.95
188 0.92
189 0.9
190 0.88
191 0.87
192 0.82
193 0.79
194 0.78
195 0.72
196 0.66
197 0.59
198 0.51
199 0.43
200 0.38
201 0.3
202 0.23
203 0.19
204 0.18
205 0.17
206 0.15
207 0.14
208 0.13
209 0.12
210 0.11
211 0.09
212 0.08
213 0.09
214 0.09
215 0.1
216 0.11
217 0.1
218 0.11
219 0.14
220 0.14
221 0.14
222 0.13
223 0.13
224 0.13
225 0.13
226 0.12
227 0.12
228 0.14
229 0.14
230 0.15
231 0.14
232 0.16
233 0.17
234 0.16
235 0.13
236 0.12
237 0.12
238 0.12
239 0.14
240 0.13
241 0.17
242 0.18
243 0.21
244 0.25
245 0.25
246 0.23
247 0.25
248 0.29
249 0.34
250 0.43
251 0.51
252 0.56
253 0.61
254 0.66
255 0.66
256 0.65
257 0.65
258 0.66
259 0.66
260 0.66
261 0.67
262 0.7
263 0.7
264 0.66
265 0.57
266 0.49
267 0.42
268 0.35
269 0.38
270 0.4
271 0.39
272 0.46
273 0.48
274 0.48
275 0.47
276 0.52
277 0.54
278 0.54
279 0.62
280 0.64
281 0.7
282 0.77
283 0.85
284 0.87
285 0.88
286 0.87
287 0.88
288 0.89
289 0.91
290 0.91
291 0.92
292 0.88
293 0.85
294 0.82
295 0.72
296 0.69
297 0.61
298 0.59
299 0.56