Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M255

Protein Details
Accession W7M255    Localization Confidence Low Confidence Score 5.5
NoLS Segment(s)
PositionSequenceProtein Nature
60-79PLIPLRPKRRVPKTPFHFLSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 21, cyto 2.5, cyto_nucl 2.5, nucl 1.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR038883  AN11006-like  
KEGG fvr:FVEG_03723  -  
Amino Acid Sequences MARRSSKSSASRPSLSSRPAGSIRIVMPSAKSAPPADPAPAVTEEDVNKINIADLTLDVPLIPLRPKRRVPKTPFHFLSLPAEVRIQIYTYFFDDVDKLLDLGPQNYKRVHKKLGLMRVCRQVHDEATFAFYSTRTFRLFPTYPGKYFKSKKPLLARLKPQQRKCVTSLELRLGPGWNAPPRGWVVNPALGLSDCVDVERLNVFVECDPSDNIFQGWRRSDGFYEGFSRNILTDVIEALPSVHTVQFDGWTSVKKSGDMMQGLMGVVNEAGLAIEWGPERGWTDTSVDEEDETQKVGYPEGFPHPGYESHGLLALA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.62
2 0.56
3 0.53
4 0.45
5 0.43
6 0.41
7 0.4
8 0.35
9 0.33
10 0.3
11 0.29
12 0.28
13 0.23
14 0.22
15 0.24
16 0.26
17 0.22
18 0.24
19 0.21
20 0.22
21 0.26
22 0.26
23 0.24
24 0.22
25 0.21
26 0.22
27 0.22
28 0.22
29 0.18
30 0.2
31 0.18
32 0.2
33 0.21
34 0.17
35 0.16
36 0.14
37 0.14
38 0.11
39 0.11
40 0.09
41 0.08
42 0.09
43 0.08
44 0.08
45 0.07
46 0.07
47 0.07
48 0.08
49 0.12
50 0.17
51 0.24
52 0.32
53 0.41
54 0.5
55 0.6
56 0.69
57 0.74
58 0.78
59 0.79
60 0.82
61 0.76
62 0.71
63 0.62
64 0.54
65 0.51
66 0.44
67 0.38
68 0.28
69 0.26
70 0.21
71 0.2
72 0.18
73 0.14
74 0.1
75 0.11
76 0.11
77 0.12
78 0.13
79 0.12
80 0.12
81 0.12
82 0.11
83 0.11
84 0.1
85 0.09
86 0.08
87 0.1
88 0.1
89 0.12
90 0.18
91 0.19
92 0.21
93 0.25
94 0.32
95 0.37
96 0.42
97 0.46
98 0.44
99 0.5
100 0.54
101 0.6
102 0.61
103 0.58
104 0.58
105 0.62
106 0.58
107 0.51
108 0.47
109 0.39
110 0.33
111 0.3
112 0.25
113 0.16
114 0.18
115 0.17
116 0.14
117 0.12
118 0.1
119 0.1
120 0.11
121 0.14
122 0.12
123 0.13
124 0.14
125 0.21
126 0.22
127 0.25
128 0.31
129 0.31
130 0.32
131 0.36
132 0.38
133 0.38
134 0.42
135 0.44
136 0.46
137 0.46
138 0.51
139 0.55
140 0.62
141 0.64
142 0.67
143 0.68
144 0.67
145 0.75
146 0.75
147 0.71
148 0.7
149 0.65
150 0.61
151 0.56
152 0.53
153 0.45
154 0.43
155 0.41
156 0.36
157 0.33
158 0.29
159 0.27
160 0.21
161 0.18
162 0.14
163 0.15
164 0.14
165 0.14
166 0.14
167 0.15
168 0.16
169 0.18
170 0.16
171 0.17
172 0.17
173 0.18
174 0.18
175 0.16
176 0.15
177 0.13
178 0.14
179 0.11
180 0.09
181 0.06
182 0.06
183 0.07
184 0.06
185 0.07
186 0.07
187 0.06
188 0.06
189 0.06
190 0.07
191 0.07
192 0.09
193 0.09
194 0.1
195 0.11
196 0.12
197 0.13
198 0.12
199 0.12
200 0.13
201 0.15
202 0.18
203 0.2
204 0.2
205 0.22
206 0.23
207 0.24
208 0.25
209 0.25
210 0.22
211 0.25
212 0.23
213 0.22
214 0.2
215 0.19
216 0.15
217 0.14
218 0.12
219 0.08
220 0.08
221 0.08
222 0.08
223 0.08
224 0.08
225 0.07
226 0.07
227 0.07
228 0.08
229 0.08
230 0.07
231 0.08
232 0.09
233 0.11
234 0.12
235 0.14
236 0.13
237 0.16
238 0.18
239 0.22
240 0.22
241 0.21
242 0.21
243 0.24
244 0.29
245 0.27
246 0.26
247 0.22
248 0.22
249 0.21
250 0.2
251 0.14
252 0.08
253 0.06
254 0.05
255 0.04
256 0.03
257 0.03
258 0.03
259 0.03
260 0.03
261 0.05
262 0.05
263 0.06
264 0.07
265 0.08
266 0.1
267 0.12
268 0.13
269 0.13
270 0.16
271 0.17
272 0.2
273 0.21
274 0.19
275 0.17
276 0.18
277 0.19
278 0.17
279 0.17
280 0.14
281 0.15
282 0.15
283 0.16
284 0.16
285 0.15
286 0.19
287 0.24
288 0.27
289 0.25
290 0.27
291 0.28
292 0.28
293 0.31
294 0.31
295 0.26
296 0.23