Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7L917

Protein Details
Accession W7L917   
Localization Confidence Low
Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
18-43PHLVISPAKRHNRKARKNQHSTPHVPHydrophilic
NLS Segment(s)
PositionSequence
26-33KRHNRKAR
Subcellular Location(s) mito 17.5, cyto_mito 10.833, extr 4, cyto 3, cyto_nucl 2.833
Family & Domain DBs
KEGG fvr:FVEG_14612  -  
Amino Acid Sequences MTAKQVHLQSTARANAIPHLVISPAKRHNRKARKNQHSTPHVPDPEDQRTRQGNANAVIWGSAYRGTLYSAGAFVSVNSSALVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.24
3 0.25
4 0.21
5 0.14
6 0.12
7 0.13
8 0.14
9 0.15
10 0.19
11 0.25
12 0.35
13 0.4
14 0.48
15 0.58
16 0.67
17 0.76
18 0.81
19 0.83
20 0.84
21 0.88
22 0.87
23 0.85
24 0.82
25 0.76
26 0.71
27 0.68
28 0.58
29 0.5
30 0.45
31 0.42
32 0.42
33 0.41
34 0.35
35 0.33
36 0.35
37 0.36
38 0.38
39 0.34
40 0.3
41 0.28
42 0.29
43 0.24
44 0.21
45 0.19
46 0.14
47 0.12
48 0.08
49 0.07
50 0.07
51 0.07
52 0.07
53 0.09
54 0.09
55 0.1
56 0.1
57 0.09
58 0.09
59 0.09
60 0.08
61 0.07
62 0.09
63 0.08
64 0.08