Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MNP9

Protein Details
Accession W7MNP9   
Localization Confidence Medium
Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
528-562DGTPKVISKKELKKLRKGRRRHSSSRNPPPSRLTAHydrophilic
NLS Segment(s)
PositionSequence
460-466KKLKKAK
534-557ISKKELKKLRKGRRRHSSSRNPPP
Subcellular Location(s) nucl 13.5, cyto 11.5, mito_nucl 8.333, cyto_mito 7.333
Family & Domain DBs
InterPro View protein in InterPro  
IPR045056  Nop56/Nop58  
IPR012974  NOP58/56_N  
IPR042239  Nop_C  
IPR002687  Nop_dom  
IPR036070  Nop_dom_sf  
IPR012976  NOSIC  
Gene Ontology GO:0031428  C:box C/D RNP complex  
GO:0005730  C:nucleolus  
GO:0032040  C:small-subunit processome  
GO:0030515  F:snoRNA binding  
GO:0017069  F:snRNA binding  
GO:0000494  P:box C/D RNA 3'-end processing  
GO:0000480  P:endonucleolytic cleavage in 5'-ETS of tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000447  P:endonucleolytic cleavage in ITS1 to separate SSU-rRNA from 5.8S rRNA and LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0000472  P:endonucleolytic cleavage to generate mature 5'-end of SSU-rRNA from (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:1902570  P:protein localization to nucleolus  
GO:0000452  P:snoRNA guided rRNA 2'-O-methylation  
KEGG fvr:FVEG_11587  -  
Pfam View protein in Pfam  
PF01798  Nop  
PF08156  NOP5NT  
PROSITE View protein in PROSITE  
PS51358  NOP  
Amino Acid Sequences MSLFVLAETPAGYGLFKATDKKMLKNEELAAELGRPEKVVEMLKLKKFVKFDSAATALEEAASLKEGKVPELLTQLLDDLKSEKKASLAVADMKLGTAISNMPSLNISPVSGSNTMDLFRGIRGGLPNLIPGLLEENFDRMALGLSHSMSRHKLKFSADKVDSMIIQAIKLLDDLDKELNVYAMRTKEWYGWHFPEMAKILNDNLAYARVILAVGMRTNIADSDLSEILPEEIETSIKAAAEISMGTEITDEDLDNIKLLADQVIVYSNYRTQLSSYLESRMRAIAPNLTALVGYLVGARLIAHAGSLISLAKSPGSTIQILGAEKALFRALKTKHDTPKYGLIYHSSLIGQATGRNKGKIARMLSAKAALGLRVDALGDAEDDADEEERAILGLSNRIKLENHLRKLEGKPLLPKGANVTPSGEIVGAGQFTLKETRRYNGDADGVADDEETTEATPAKKLKKAKKLIEEVDEEMKDAEDSDDEAATPGKPKKLSEADYERLAEEAGISVKKFKRKYERGDVELNADGTPKVISKKELKKLRKGRRRHSSSRNPPPSRLTAESAAR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.12
4 0.17
5 0.19
6 0.28
7 0.32
8 0.39
9 0.46
10 0.51
11 0.53
12 0.54
13 0.55
14 0.49
15 0.47
16 0.41
17 0.33
18 0.26
19 0.24
20 0.2
21 0.16
22 0.14
23 0.12
24 0.12
25 0.15
26 0.18
27 0.2
28 0.27
29 0.35
30 0.39
31 0.47
32 0.47
33 0.48
34 0.48
35 0.46
36 0.46
37 0.41
38 0.39
39 0.38
40 0.39
41 0.35
42 0.33
43 0.31
44 0.22
45 0.19
46 0.17
47 0.1
48 0.08
49 0.09
50 0.08
51 0.08
52 0.11
53 0.12
54 0.13
55 0.15
56 0.16
57 0.17
58 0.2
59 0.2
60 0.17
61 0.17
62 0.17
63 0.15
64 0.14
65 0.12
66 0.12
67 0.15
68 0.17
69 0.18
70 0.18
71 0.18
72 0.2
73 0.2
74 0.2
75 0.21
76 0.23
77 0.23
78 0.23
79 0.22
80 0.2
81 0.19
82 0.15
83 0.11
84 0.07
85 0.07
86 0.07
87 0.1
88 0.1
89 0.1
90 0.11
91 0.11
92 0.13
93 0.12
94 0.11
95 0.1
96 0.11
97 0.15
98 0.15
99 0.15
100 0.14
101 0.15
102 0.15
103 0.14
104 0.14
105 0.1
106 0.09
107 0.1
108 0.09
109 0.1
110 0.12
111 0.13
112 0.15
113 0.14
114 0.15
115 0.14
116 0.14
117 0.11
118 0.09
119 0.11
120 0.1
121 0.1
122 0.1
123 0.11
124 0.11
125 0.11
126 0.11
127 0.07
128 0.08
129 0.07
130 0.08
131 0.08
132 0.09
133 0.11
134 0.12
135 0.14
136 0.18
137 0.24
138 0.26
139 0.27
140 0.3
141 0.35
142 0.43
143 0.45
144 0.5
145 0.45
146 0.43
147 0.42
148 0.4
149 0.34
150 0.25
151 0.24
152 0.14
153 0.12
154 0.11
155 0.1
156 0.09
157 0.09
158 0.08
159 0.06
160 0.07
161 0.09
162 0.09
163 0.09
164 0.09
165 0.09
166 0.09
167 0.09
168 0.09
169 0.1
170 0.1
171 0.11
172 0.12
173 0.13
174 0.16
175 0.2
176 0.23
177 0.26
178 0.28
179 0.29
180 0.3
181 0.29
182 0.3
183 0.27
184 0.25
185 0.19
186 0.16
187 0.16
188 0.16
189 0.16
190 0.12
191 0.11
192 0.1
193 0.09
194 0.09
195 0.08
196 0.05
197 0.05
198 0.05
199 0.05
200 0.05
201 0.05
202 0.05
203 0.05
204 0.05
205 0.05
206 0.05
207 0.06
208 0.05
209 0.05
210 0.09
211 0.09
212 0.09
213 0.09
214 0.09
215 0.08
216 0.08
217 0.07
218 0.04
219 0.04
220 0.05
221 0.05
222 0.05
223 0.06
224 0.05
225 0.06
226 0.05
227 0.05
228 0.05
229 0.05
230 0.04
231 0.04
232 0.04
233 0.04
234 0.04
235 0.04
236 0.05
237 0.05
238 0.04
239 0.05
240 0.06
241 0.06
242 0.06
243 0.06
244 0.06
245 0.06
246 0.06
247 0.05
248 0.04
249 0.04
250 0.04
251 0.06
252 0.06
253 0.06
254 0.07
255 0.08
256 0.09
257 0.09
258 0.09
259 0.09
260 0.12
261 0.15
262 0.17
263 0.17
264 0.2
265 0.21
266 0.21
267 0.21
268 0.18
269 0.16
270 0.14
271 0.14
272 0.12
273 0.11
274 0.11
275 0.1
276 0.09
277 0.08
278 0.07
279 0.07
280 0.04
281 0.04
282 0.03
283 0.03
284 0.03
285 0.03
286 0.03
287 0.03
288 0.03
289 0.03
290 0.03
291 0.03
292 0.03
293 0.03
294 0.03
295 0.03
296 0.03
297 0.04
298 0.04
299 0.04
300 0.04
301 0.05
302 0.06
303 0.08
304 0.08
305 0.08
306 0.1
307 0.12
308 0.12
309 0.12
310 0.11
311 0.09
312 0.08
313 0.09
314 0.09
315 0.07
316 0.07
317 0.14
318 0.15
319 0.23
320 0.29
321 0.36
322 0.43
323 0.48
324 0.5
325 0.47
326 0.54
327 0.49
328 0.44
329 0.37
330 0.33
331 0.29
332 0.27
333 0.24
334 0.15
335 0.12
336 0.11
337 0.11
338 0.08
339 0.1
340 0.12
341 0.18
342 0.2
343 0.2
344 0.21
345 0.24
346 0.28
347 0.31
348 0.31
349 0.3
350 0.31
351 0.32
352 0.33
353 0.3
354 0.26
355 0.22
356 0.19
357 0.14
358 0.11
359 0.09
360 0.08
361 0.07
362 0.07
363 0.05
364 0.05
365 0.04
366 0.04
367 0.04
368 0.04
369 0.04
370 0.04
371 0.04
372 0.05
373 0.04
374 0.04
375 0.04
376 0.04
377 0.04
378 0.04
379 0.05
380 0.05
381 0.11
382 0.12
383 0.15
384 0.15
385 0.17
386 0.17
387 0.2
388 0.31
389 0.35
390 0.39
391 0.4
392 0.41
393 0.45
394 0.47
395 0.51
396 0.45
397 0.39
398 0.41
399 0.42
400 0.46
401 0.41
402 0.4
403 0.37
404 0.36
405 0.35
406 0.29
407 0.27
408 0.22
409 0.22
410 0.22
411 0.16
412 0.11
413 0.1
414 0.1
415 0.07
416 0.06
417 0.06
418 0.05
419 0.07
420 0.13
421 0.15
422 0.21
423 0.23
424 0.26
425 0.31
426 0.34
427 0.34
428 0.32
429 0.33
430 0.27
431 0.26
432 0.24
433 0.19
434 0.16
435 0.14
436 0.1
437 0.08
438 0.07
439 0.06
440 0.05
441 0.06
442 0.07
443 0.08
444 0.12
445 0.17
446 0.23
447 0.29
448 0.38
449 0.47
450 0.56
451 0.66
452 0.71
453 0.76
454 0.79
455 0.79
456 0.76
457 0.7
458 0.63
459 0.6
460 0.5
461 0.41
462 0.32
463 0.26
464 0.2
465 0.16
466 0.13
467 0.07
468 0.08
469 0.09
470 0.09
471 0.08
472 0.09
473 0.09
474 0.09
475 0.16
476 0.18
477 0.23
478 0.25
479 0.26
480 0.34
481 0.42
482 0.45
483 0.49
484 0.53
485 0.52
486 0.54
487 0.54
488 0.45
489 0.37
490 0.33
491 0.23
492 0.15
493 0.13
494 0.11
495 0.11
496 0.11
497 0.19
498 0.24
499 0.32
500 0.36
501 0.44
502 0.53
503 0.61
504 0.71
505 0.74
506 0.79
507 0.76
508 0.79
509 0.71
510 0.65
511 0.58
512 0.49
513 0.38
514 0.29
515 0.23
516 0.17
517 0.16
518 0.14
519 0.15
520 0.17
521 0.23
522 0.32
523 0.43
524 0.52
525 0.62
526 0.68
527 0.74
528 0.83
529 0.88
530 0.87
531 0.88
532 0.89
533 0.9
534 0.91
535 0.91
536 0.91
537 0.91
538 0.93
539 0.94
540 0.94
541 0.88
542 0.84
543 0.81
544 0.77
545 0.73
546 0.67
547 0.61