Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7MNU8

Protein Details
Accession W7MNU8    Localization Confidence Low Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
61-80SNYPEKKRWQAKGKGEPKNTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 10, mito 8, cyto_nucl 8
Family & Domain DBs
KEGG fvr:FVEG_15949  -  
Amino Acid Sequences MQIRTFLVSNDEKPWAYPLRILLTGYDRRRMTPQLPPNKNTFSGWGPETVKIAVDCTGTPSNYPEKKRWQAKGKGEPKNTQNPELLQQDAPIRPGRCTTELVPRFCRGE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.31
2 0.28
3 0.25
4 0.25
5 0.25
6 0.27
7 0.28
8 0.27
9 0.24
10 0.27
11 0.34
12 0.34
13 0.38
14 0.33
15 0.34
16 0.38
17 0.4
18 0.37
19 0.39
20 0.46
21 0.49
22 0.54
23 0.55
24 0.56
25 0.55
26 0.53
27 0.44
28 0.38
29 0.29
30 0.26
31 0.24
32 0.23
33 0.21
34 0.2
35 0.2
36 0.16
37 0.15
38 0.12
39 0.12
40 0.09
41 0.08
42 0.07
43 0.11
44 0.12
45 0.11
46 0.12
47 0.13
48 0.21
49 0.26
50 0.29
51 0.3
52 0.38
53 0.47
54 0.55
55 0.61
56 0.63
57 0.67
58 0.73
59 0.79
60 0.8
61 0.8
62 0.78
63 0.76
64 0.72
65 0.74
66 0.67
67 0.6
68 0.53
69 0.46
70 0.46
71 0.43
72 0.39
73 0.28
74 0.27
75 0.28
76 0.26
77 0.27
78 0.27
79 0.25
80 0.24
81 0.28
82 0.31
83 0.29
84 0.33
85 0.33
86 0.38
87 0.44
88 0.48
89 0.5