Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7N6C2

Protein Details
Accession W7N6C2    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
37-61REGPSTPPRRIARRNTRGKKTAPKSBasic
NLS Segment(s)
PositionSequence
43-67PPRRIARRNTRGKKTAPKSRLERDK
Subcellular Location(s) nucl 17.5, cyto_nucl 10.5, mito 7
Family & Domain DBs
KEGG fvr:FVEG_17560  -  
Amino Acid Sequences MPALRETPSSQLAVQRHPLPSSAPKRTASQMDEDTNREGPSTPPRRIARRNTRGKKTAPKSRLERDKDGKSQSPSPSISLLAAPTEYAVATHFTIILGHGCIYYAEDSPPLFVPSTMMHMHLASGAYPYHCHQLQAASISQMQGVHMPSIGAPVHGHGVGLGWNENAWGYVPGCEVGDLSQMHGNLNFSHKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.37
3 0.37
4 0.36
5 0.36
6 0.34
7 0.41
8 0.45
9 0.47
10 0.47
11 0.47
12 0.49
13 0.54
14 0.55
15 0.47
16 0.45
17 0.42
18 0.43
19 0.44
20 0.43
21 0.41
22 0.36
23 0.34
24 0.27
25 0.23
26 0.2
27 0.28
28 0.33
29 0.32
30 0.39
31 0.45
32 0.52
33 0.6
34 0.68
35 0.69
36 0.72
37 0.8
38 0.81
39 0.85
40 0.83
41 0.82
42 0.82
43 0.8
44 0.79
45 0.74
46 0.73
47 0.71
48 0.74
49 0.77
50 0.73
51 0.73
52 0.7
53 0.71
54 0.69
55 0.67
56 0.63
57 0.57
58 0.56
59 0.5
60 0.47
61 0.41
62 0.36
63 0.31
64 0.26
65 0.22
66 0.16
67 0.14
68 0.09
69 0.08
70 0.06
71 0.05
72 0.05
73 0.04
74 0.04
75 0.04
76 0.05
77 0.05
78 0.05
79 0.05
80 0.05
81 0.05
82 0.06
83 0.05
84 0.04
85 0.04
86 0.04
87 0.04
88 0.04
89 0.05
90 0.06
91 0.06
92 0.06
93 0.07
94 0.07
95 0.08
96 0.08
97 0.09
98 0.08
99 0.07
100 0.08
101 0.08
102 0.12
103 0.11
104 0.12
105 0.11
106 0.11
107 0.11
108 0.11
109 0.1
110 0.06
111 0.07
112 0.06
113 0.06
114 0.08
115 0.09
116 0.13
117 0.13
118 0.14
119 0.13
120 0.15
121 0.16
122 0.18
123 0.17
124 0.14
125 0.15
126 0.14
127 0.15
128 0.12
129 0.11
130 0.11
131 0.11
132 0.09
133 0.09
134 0.09
135 0.08
136 0.11
137 0.1
138 0.09
139 0.08
140 0.09
141 0.11
142 0.1
143 0.1
144 0.07
145 0.08
146 0.09
147 0.1
148 0.09
149 0.07
150 0.07
151 0.08
152 0.08
153 0.08
154 0.07
155 0.08
156 0.08
157 0.09
158 0.1
159 0.11
160 0.11
161 0.11
162 0.1
163 0.09
164 0.13
165 0.12
166 0.14
167 0.16
168 0.16
169 0.17
170 0.18
171 0.19
172 0.16