Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MMH2

Protein Details
Accession W7MMH2   
Localization Confidence Medium
Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
1-27MATTTTVRKDHKKWKCNKNISGKLCGTHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, mito 12
Family & Domain DBs
KEGG fvr:FVEG_16369  -  
Amino Acid Sequences MATTTTVRKDHKKWKCNKNISGKLCGTITSMSNKYCDKCDKRRQVDDEALASDESSIGRLYHLATDLTEHWEYTSPEPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.86
3 0.88
4 0.88
5 0.89
6 0.88
7 0.83
8 0.8
9 0.7
10 0.61
11 0.51
12 0.42
13 0.33
14 0.24
15 0.21
16 0.18
17 0.19
18 0.17
19 0.2
20 0.21
21 0.2
22 0.23
23 0.3
24 0.32
25 0.4
26 0.5
27 0.58
28 0.64
29 0.7
30 0.7
31 0.68
32 0.66
33 0.58
34 0.49
35 0.4
36 0.33
37 0.26
38 0.21
39 0.14
40 0.1
41 0.07
42 0.06
43 0.06
44 0.05
45 0.05
46 0.06
47 0.07
48 0.08
49 0.1
50 0.09
51 0.09
52 0.12
53 0.13
54 0.18
55 0.18
56 0.16
57 0.16
58 0.2
59 0.22