Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7LV21

Protein Details
Accession W7LV21   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
1-21MRDKSKWTKTPKKRDLGLTRFHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 18.5, mito_nucl 11.5, cyto 5
Family & Domain DBs
KEGG fvr:FVEG_15428  -  
Amino Acid Sequences MRDKSKWTKTPKKRDLGLTRFAAKPYGLCRSNFHEYWVECKFEVESVVSMVTAQRLDIVQQFGGVAKPRPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.85
2 0.85
3 0.8
4 0.76
5 0.7
6 0.64
7 0.56
8 0.5
9 0.41
10 0.31
11 0.27
12 0.22
13 0.25
14 0.23
15 0.23
16 0.26
17 0.31
18 0.36
19 0.34
20 0.33
21 0.3
22 0.28
23 0.32
24 0.31
25 0.26
26 0.2
27 0.2
28 0.18
29 0.13
30 0.14
31 0.1
32 0.08
33 0.07
34 0.07
35 0.07
36 0.07
37 0.07
38 0.07
39 0.06
40 0.06
41 0.06
42 0.06
43 0.08
44 0.11
45 0.13
46 0.12
47 0.12
48 0.13
49 0.12
50 0.15
51 0.17