Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7N609

Protein Details
Accession W7N609    Localization Confidence Medium Confidence Score 10.6
NoLS Segment(s)
PositionSequenceProtein Nature
10-29RPPAAFRKDARSKKAKATINHydrophilic
NLS Segment(s)
PositionSequence
16-25RKDARSKKAK
Subcellular Location(s) cyto_nucl 10, nucl 9, cyto 9, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR012664  CHP02452  
IPR043472  Macro_dom-like  
IPR019261  PARG_cat_microbial  
KEGG fvr:FVEG_10885  -  
Pfam View protein in Pfam  
PF10021  DUF2263  
Amino Acid Sequences MGRTEPSIGRPPAAFRKDARSKKAKATINKVIPSLLTGYPGAQKGINSAELIPFMNATVLPEPYGKLLKKQDDKGDAATKGKFTQGAEDPHEDLAKLKPPRISIREVDTLTAARDLLNIETPAGVKTDFVNTRAHVAILNMGSPLNPGGGFLNGANSQEESLCMRTTLYPSLKDEWYRLPELSSIWTPTVLVFRDEDGNDIDKKDRFYVDCITAAMIRGPEFELGEDGVASYANKKDRETAQAKMRAVMRIAMVKRCKRLVLGAWGCGAHGNPVGEIARAWKSVLTPKYDKSKLKERWEYVDEIVFAIKDHNMAQAFAEAWGDGIELQDEEKNEIQEEEEKDAEEVDPADVKTQELKDKIRELEHRIQRVNNPKVLDGLKAILDGLEKQLPEEDEALTQDSEWEHVKAEGTGSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.4
3 0.49
4 0.57
5 0.65
6 0.67
7 0.67
8 0.68
9 0.74
10 0.8
11 0.78
12 0.77
13 0.78
14 0.78
15 0.78
16 0.75
17 0.66
18 0.58
19 0.49
20 0.42
21 0.36
22 0.26
23 0.2
24 0.16
25 0.17
26 0.21
27 0.22
28 0.21
29 0.18
30 0.17
31 0.18
32 0.21
33 0.2
34 0.17
35 0.17
36 0.17
37 0.17
38 0.18
39 0.15
40 0.12
41 0.1
42 0.1
43 0.09
44 0.1
45 0.11
46 0.11
47 0.12
48 0.12
49 0.13
50 0.15
51 0.22
52 0.2
53 0.26
54 0.33
55 0.42
56 0.49
57 0.55
58 0.6
59 0.6
60 0.62
61 0.61
62 0.59
63 0.53
64 0.48
65 0.44
66 0.38
67 0.32
68 0.32
69 0.28
70 0.21
71 0.25
72 0.27
73 0.31
74 0.33
75 0.35
76 0.35
77 0.34
78 0.33
79 0.26
80 0.22
81 0.2
82 0.23
83 0.23
84 0.25
85 0.26
86 0.31
87 0.39
88 0.43
89 0.45
90 0.41
91 0.45
92 0.48
93 0.45
94 0.41
95 0.34
96 0.3
97 0.25
98 0.22
99 0.15
100 0.09
101 0.09
102 0.09
103 0.09
104 0.1
105 0.1
106 0.09
107 0.1
108 0.1
109 0.1
110 0.1
111 0.09
112 0.07
113 0.08
114 0.14
115 0.15
116 0.17
117 0.19
118 0.18
119 0.22
120 0.21
121 0.21
122 0.14
123 0.13
124 0.15
125 0.12
126 0.12
127 0.09
128 0.09
129 0.09
130 0.08
131 0.08
132 0.05
133 0.05
134 0.05
135 0.05
136 0.06
137 0.06
138 0.06
139 0.09
140 0.09
141 0.09
142 0.09
143 0.09
144 0.09
145 0.08
146 0.09
147 0.08
148 0.09
149 0.09
150 0.08
151 0.09
152 0.09
153 0.12
154 0.17
155 0.18
156 0.18
157 0.21
158 0.24
159 0.26
160 0.26
161 0.26
162 0.24
163 0.26
164 0.26
165 0.23
166 0.2
167 0.19
168 0.19
169 0.19
170 0.15
171 0.13
172 0.11
173 0.11
174 0.1
175 0.1
176 0.12
177 0.1
178 0.1
179 0.09
180 0.09
181 0.12
182 0.12
183 0.12
184 0.11
185 0.13
186 0.12
187 0.13
188 0.14
189 0.13
190 0.14
191 0.15
192 0.15
193 0.14
194 0.16
195 0.19
196 0.18
197 0.17
198 0.16
199 0.15
200 0.14
201 0.13
202 0.11
203 0.08
204 0.06
205 0.06
206 0.07
207 0.07
208 0.06
209 0.06
210 0.06
211 0.06
212 0.05
213 0.05
214 0.04
215 0.04
216 0.04
217 0.04
218 0.05
219 0.08
220 0.12
221 0.13
222 0.14
223 0.18
224 0.21
225 0.3
226 0.31
227 0.34
228 0.38
229 0.44
230 0.43
231 0.43
232 0.42
233 0.35
234 0.32
235 0.28
236 0.21
237 0.21
238 0.22
239 0.25
240 0.3
241 0.33
242 0.37
243 0.37
244 0.36
245 0.31
246 0.33
247 0.31
248 0.34
249 0.33
250 0.3
251 0.29
252 0.29
253 0.27
254 0.24
255 0.2
256 0.1
257 0.1
258 0.09
259 0.07
260 0.09
261 0.1
262 0.09
263 0.09
264 0.11
265 0.11
266 0.11
267 0.12
268 0.11
269 0.12
270 0.2
271 0.23
272 0.27
273 0.28
274 0.33
275 0.42
276 0.48
277 0.52
278 0.5
279 0.58
280 0.6
281 0.67
282 0.71
283 0.65
284 0.66
285 0.64
286 0.62
287 0.53
288 0.46
289 0.36
290 0.28
291 0.24
292 0.17
293 0.13
294 0.11
295 0.1
296 0.08
297 0.08
298 0.12
299 0.12
300 0.12
301 0.12
302 0.12
303 0.12
304 0.12
305 0.11
306 0.07
307 0.07
308 0.06
309 0.06
310 0.05
311 0.04
312 0.05
313 0.04
314 0.06
315 0.07
316 0.08
317 0.11
318 0.13
319 0.14
320 0.14
321 0.14
322 0.15
323 0.19
324 0.21
325 0.22
326 0.2
327 0.2
328 0.2
329 0.2
330 0.19
331 0.14
332 0.12
333 0.09
334 0.11
335 0.1
336 0.13
337 0.13
338 0.13
339 0.18
340 0.2
341 0.26
342 0.29
343 0.33
344 0.37
345 0.43
346 0.46
347 0.48
348 0.51
349 0.53
350 0.58
351 0.62
352 0.64
353 0.62
354 0.63
355 0.64
356 0.69
357 0.67
358 0.61
359 0.55
360 0.48
361 0.5
362 0.46
363 0.4
364 0.31
365 0.26
366 0.22
367 0.19
368 0.19
369 0.14
370 0.13
371 0.12
372 0.14
373 0.15
374 0.15
375 0.15
376 0.19
377 0.19
378 0.21
379 0.21
380 0.18
381 0.16
382 0.18
383 0.2
384 0.16
385 0.15
386 0.15
387 0.14
388 0.15
389 0.16
390 0.15
391 0.14
392 0.15
393 0.16
394 0.15