Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MYW9

Protein Details
Accession W7MYW9   
Localization Confidence Low
Confidence Score 7.7
NoLS Segment(s)
PositionSequenceProtein Nature
82-104SDKRFKLTMTARRRERYRRHIDQBasic
NLS Segment(s)
Subcellular Location(s) mito 17, nucl 7, plas 2
Family & Domain DBs
KEGG fvr:FVEG_17045  -  
Amino Acid Sequences MCIRRLHGIRHVRWLFMTSNGYCAMMVKNGARNHQDQPFERTPKSCKTTETMKDAEKATSNHARNQLSGEQLPDGWNTAPPSDKRFKLTMTARRRERYRRHIDQ
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.37
3 0.31
4 0.34
5 0.23
6 0.24
7 0.23
8 0.23
9 0.19
10 0.19
11 0.15
12 0.11
13 0.13
14 0.12
15 0.18
16 0.2
17 0.24
18 0.26
19 0.28
20 0.31
21 0.35
22 0.38
23 0.34
24 0.4
25 0.44
26 0.45
27 0.43
28 0.42
29 0.41
30 0.43
31 0.46
32 0.39
33 0.33
34 0.32
35 0.4
36 0.41
37 0.42
38 0.37
39 0.34
40 0.35
41 0.34
42 0.31
43 0.26
44 0.22
45 0.22
46 0.28
47 0.28
48 0.3
49 0.35
50 0.35
51 0.32
52 0.35
53 0.32
54 0.27
55 0.26
56 0.22
57 0.17
58 0.16
59 0.17
60 0.13
61 0.13
62 0.1
63 0.12
64 0.12
65 0.13
66 0.17
67 0.18
68 0.25
69 0.31
70 0.33
71 0.35
72 0.36
73 0.37
74 0.41
75 0.49
76 0.52
77 0.55
78 0.63
79 0.66
80 0.72
81 0.79
82 0.8
83 0.82
84 0.83