Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7M8W1

Protein Details
Accession W7M8W1    Localization Confidence Medium Confidence Score 13.2
NoLS Segment(s)
PositionSequenceProtein Nature
40-64AKTSPPKKVTKATNVKKQEKPKAPAHydrophilic
NLS Segment(s)
PositionSequence
18-80APKRRSLRQAAKGNPEPEAPPPAKTSPPKKVTKATNVKKQEKPKAPAKTEEPEAPKVKKTAKK
Subcellular Location(s) nucl 21, cyto_nucl 14, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR002740  EVE_domain  
IPR015947  PUA-like_sf  
IPR047197  THYN1-like_EVE  
Gene Ontology GO:0005634  C:nucleus  
KEGG fvr:FVEG_03501  -  
Pfam View protein in Pfam  
PF01878  EVE  
CDD cd21133  EVE  
Amino Acid Sequences MPPRKRSAPTADASEEAAPKRRSLRQAAKGNPEPEAPPPAKTSPPKKVTKATNVKKQEKPKAPAKTEEPEAPKVKKTAKKQEPAQSSSRGVSEDPDIDSIPTINPDAPKHDGQWYWLMKAEPETRIENGVDVKFSIDDLKAKTEPEGWDGIRAYAARNNMRNMNAGDLAFFYASNCKEPGIVGIMEIVKEFSEDRSARRPGAPYYDPKSTKEKPIWDLVHVEFRKKFAVPIGLKELRELGKPGGPLEMMQLLKQSRLSVSKVSGEEWRFLCELADKKAKDAGLKHDEGEK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.38
3 0.32
4 0.36
5 0.3
6 0.31
7 0.36
8 0.41
9 0.45
10 0.52
11 0.6
12 0.61
13 0.7
14 0.75
15 0.78
16 0.79
17 0.74
18 0.65
19 0.57
20 0.49
21 0.42
22 0.42
23 0.33
24 0.28
25 0.31
26 0.32
27 0.38
28 0.44
29 0.5
30 0.52
31 0.6
32 0.65
33 0.66
34 0.72
35 0.72
36 0.75
37 0.77
38 0.76
39 0.78
40 0.8
41 0.83
42 0.83
43 0.84
44 0.84
45 0.82
46 0.8
47 0.79
48 0.79
49 0.75
50 0.73
51 0.69
52 0.65
53 0.59
54 0.59
55 0.55
56 0.52
57 0.53
58 0.49
59 0.46
60 0.45
61 0.49
62 0.5
63 0.54
64 0.58
65 0.62
66 0.68
67 0.74
68 0.78
69 0.77
70 0.75
71 0.69
72 0.63
73 0.55
74 0.48
75 0.4
76 0.32
77 0.24
78 0.21
79 0.18
80 0.15
81 0.14
82 0.14
83 0.13
84 0.12
85 0.12
86 0.11
87 0.09
88 0.08
89 0.08
90 0.08
91 0.1
92 0.11
93 0.15
94 0.18
95 0.19
96 0.2
97 0.24
98 0.22
99 0.23
100 0.3
101 0.27
102 0.24
103 0.25
104 0.23
105 0.19
106 0.24
107 0.25
108 0.19
109 0.2
110 0.21
111 0.19
112 0.21
113 0.2
114 0.16
115 0.16
116 0.14
117 0.12
118 0.1
119 0.1
120 0.08
121 0.08
122 0.08
123 0.06
124 0.08
125 0.09
126 0.12
127 0.13
128 0.13
129 0.13
130 0.15
131 0.15
132 0.15
133 0.17
134 0.14
135 0.15
136 0.15
137 0.15
138 0.13
139 0.12
140 0.11
141 0.11
142 0.15
143 0.16
144 0.19
145 0.21
146 0.22
147 0.23
148 0.25
149 0.23
150 0.21
151 0.18
152 0.16
153 0.14
154 0.11
155 0.11
156 0.09
157 0.08
158 0.06
159 0.09
160 0.09
161 0.11
162 0.11
163 0.1
164 0.1
165 0.1
166 0.11
167 0.1
168 0.1
169 0.08
170 0.09
171 0.09
172 0.09
173 0.09
174 0.08
175 0.05
176 0.06
177 0.06
178 0.05
179 0.12
180 0.13
181 0.17
182 0.24
183 0.26
184 0.28
185 0.3
186 0.32
187 0.28
188 0.34
189 0.35
190 0.35
191 0.38
192 0.45
193 0.44
194 0.45
195 0.5
196 0.46
197 0.51
198 0.5
199 0.51
200 0.46
201 0.53
202 0.52
203 0.46
204 0.47
205 0.4
206 0.44
207 0.39
208 0.4
209 0.32
210 0.32
211 0.33
212 0.28
213 0.28
214 0.22
215 0.31
216 0.28
217 0.32
218 0.39
219 0.41
220 0.4
221 0.4
222 0.4
223 0.32
224 0.31
225 0.29
226 0.22
227 0.21
228 0.22
229 0.22
230 0.19
231 0.18
232 0.16
233 0.16
234 0.2
235 0.17
236 0.16
237 0.2
238 0.19
239 0.21
240 0.22
241 0.2
242 0.19
243 0.22
244 0.25
245 0.24
246 0.27
247 0.32
248 0.31
249 0.32
250 0.36
251 0.34
252 0.37
253 0.33
254 0.34
255 0.28
256 0.27
257 0.26
258 0.25
259 0.27
260 0.3
261 0.38
262 0.34
263 0.36
264 0.4
265 0.41
266 0.4
267 0.4
268 0.42
269 0.42
270 0.44