Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MV43

Protein Details
Accession W7MV43   
Localization Confidence Medium
Confidence Score 11.5
NoLS Segment(s)
PositionSequenceProtein Nature
50-72LLSCCLFSRRRKRRGVKPVYGTGHydrophilic
NLS Segment(s)
PositionSequence
58-64RRRKRRG
Subcellular Location(s) nucl 9, extr 7, mito 6, pero 2, golg 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR020999  Chitin_synth_reg_RCR  
Gene Ontology GO:0016020  C:membrane  
KEGG fvr:FVEG_08105  -  
Pfam View protein in Pfam  
PF12273  RCR  
Amino Acid Sequences MVPTEDIFARDYYRCRYGQTWNGRACVRNNWSYWGRWVLAGIIIFFFVLLLSCCLFSRRRKRRGVKPVYGTGWMAAKPWGNNNNNHQMYNYGNQGGYNQGYQQNNGGYGAPPPPPAYGQQQQPQYTGTTFNTNDGYYGQGQYSGVQQPQGTYQREGAYSPPAGPPPGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.32
3 0.35
4 0.41
5 0.47
6 0.54
7 0.57
8 0.55
9 0.58
10 0.56
11 0.56
12 0.5
13 0.5
14 0.46
15 0.42
16 0.4
17 0.42
18 0.43
19 0.41
20 0.42
21 0.37
22 0.32
23 0.26
24 0.25
25 0.19
26 0.19
27 0.17
28 0.13
29 0.09
30 0.08
31 0.08
32 0.07
33 0.06
34 0.03
35 0.03
36 0.04
37 0.05
38 0.05
39 0.06
40 0.06
41 0.08
42 0.13
43 0.22
44 0.33
45 0.43
46 0.52
47 0.61
48 0.71
49 0.79
50 0.86
51 0.87
52 0.84
53 0.8
54 0.77
55 0.69
56 0.61
57 0.5
58 0.4
59 0.31
60 0.22
61 0.17
62 0.12
63 0.11
64 0.1
65 0.15
66 0.22
67 0.23
68 0.26
69 0.31
70 0.39
71 0.39
72 0.39
73 0.34
74 0.28
75 0.28
76 0.27
77 0.23
78 0.14
79 0.13
80 0.12
81 0.13
82 0.13
83 0.11
84 0.09
85 0.09
86 0.14
87 0.14
88 0.15
89 0.16
90 0.15
91 0.15
92 0.15
93 0.14
94 0.09
95 0.1
96 0.12
97 0.11
98 0.11
99 0.12
100 0.12
101 0.13
102 0.15
103 0.21
104 0.24
105 0.29
106 0.34
107 0.4
108 0.4
109 0.4
110 0.39
111 0.34
112 0.29
113 0.27
114 0.22
115 0.22
116 0.21
117 0.22
118 0.23
119 0.21
120 0.21
121 0.18
122 0.19
123 0.14
124 0.15
125 0.13
126 0.12
127 0.12
128 0.12
129 0.16
130 0.17
131 0.16
132 0.17
133 0.17
134 0.17
135 0.25
136 0.31
137 0.31
138 0.29
139 0.32
140 0.33
141 0.34
142 0.34
143 0.28
144 0.27
145 0.25
146 0.24
147 0.24
148 0.24