Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M9E4

Protein Details
Accession W7M9E4    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
27-47ATGKRLKTRPHWAKPPRSGMSHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 10, pero 7.5, cyto_pero 7.5, cyto 6.5, mito_nucl 6.5
Family & Domain DBs
KEGG fvr:FVEG_16163  -  
Amino Acid Sequences MDAIAADIWEPFEQSVLDEWVALKDPATGKRLKTRPHWAKPPRSGMSICLMVTCGSRGLM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.08
2 0.1
3 0.1
4 0.09
5 0.09
6 0.09
7 0.09
8 0.11
9 0.1
10 0.08
11 0.09
12 0.11
13 0.14
14 0.17
15 0.18
16 0.19
17 0.28
18 0.33
19 0.36
20 0.41
21 0.49
22 0.56
23 0.63
24 0.72
25 0.72
26 0.77
27 0.8
28 0.82
29 0.74
30 0.68
31 0.6
32 0.52
33 0.48
34 0.41
35 0.33
36 0.24
37 0.22
38 0.18
39 0.18
40 0.17