Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M2E6

Protein Details
Accession W7M2E6    Localization Confidence High Confidence Score 16.1
NoLS Segment(s)
PositionSequenceProtein Nature
1-30MVKPLTFKGDKKVKKRKRTDPEKSQRDGVDBasic
NLS Segment(s)
PositionSequence
9-19GDKKVKKRKRT
200-222RFKPKLRASKEEKALAKISRREL
236-242RRLKRAR
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR008999  Actin-crosslinking  
IPR010414  FRG1  
Gene Ontology GO:0005730  C:nucleolus  
KEGG fvr:FVEG_03784  -  
Pfam View protein in Pfam  
PF06229  FRG1  
Amino Acid Sequences MVKPLTFKGDKKVKKRKRTDPEKSQRDGVDDEAGQLQKTGEEAENDDSWVSAEAATDVVGPIMIVLPTDEPSALACDTTGKVFTIPIENIVDGNPSTAEPHDVRQVWVANRVAGTESFRFKGHHGRSASSQQPPEAVSPLESFNVIPTGDTPGTFQLQTLRDTFLTIKAPSKASSKAVDVRGDADDISFDTTFRIRMQARFKPKLRASKEEKALAKISRRELEEAAGRRLDEDEVRRLKRARREGDYHEALLEIKVKSKHDKFS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.9
3 0.9
4 0.91
5 0.94
6 0.94
7 0.94
8 0.95
9 0.93
10 0.87
11 0.83
12 0.73
13 0.66
14 0.57
15 0.48
16 0.42
17 0.33
18 0.29
19 0.27
20 0.26
21 0.22
22 0.2
23 0.17
24 0.12
25 0.12
26 0.13
27 0.1
28 0.11
29 0.14
30 0.17
31 0.18
32 0.18
33 0.17
34 0.15
35 0.13
36 0.13
37 0.11
38 0.07
39 0.06
40 0.06
41 0.06
42 0.07
43 0.06
44 0.05
45 0.04
46 0.04
47 0.04
48 0.03
49 0.04
50 0.03
51 0.03
52 0.04
53 0.05
54 0.06
55 0.07
56 0.07
57 0.06
58 0.07
59 0.09
60 0.08
61 0.08
62 0.07
63 0.08
64 0.09
65 0.09
66 0.1
67 0.08
68 0.08
69 0.09
70 0.09
71 0.12
72 0.11
73 0.13
74 0.13
75 0.13
76 0.13
77 0.12
78 0.13
79 0.09
80 0.09
81 0.07
82 0.06
83 0.07
84 0.07
85 0.1
86 0.1
87 0.12
88 0.17
89 0.17
90 0.17
91 0.19
92 0.22
93 0.19
94 0.24
95 0.23
96 0.18
97 0.18
98 0.17
99 0.16
100 0.13
101 0.15
102 0.12
103 0.14
104 0.14
105 0.15
106 0.16
107 0.16
108 0.26
109 0.25
110 0.3
111 0.29
112 0.3
113 0.33
114 0.38
115 0.4
116 0.34
117 0.32
118 0.25
119 0.25
120 0.24
121 0.21
122 0.17
123 0.12
124 0.1
125 0.1
126 0.11
127 0.1
128 0.09
129 0.08
130 0.07
131 0.08
132 0.07
133 0.06
134 0.06
135 0.1
136 0.1
137 0.1
138 0.1
139 0.11
140 0.12
141 0.12
142 0.12
143 0.13
144 0.14
145 0.16
146 0.16
147 0.17
148 0.15
149 0.17
150 0.17
151 0.15
152 0.17
153 0.16
154 0.18
155 0.18
156 0.2
157 0.2
158 0.23
159 0.22
160 0.22
161 0.24
162 0.24
163 0.28
164 0.3
165 0.3
166 0.27
167 0.27
168 0.25
169 0.23
170 0.19
171 0.13
172 0.1
173 0.08
174 0.11
175 0.08
176 0.08
177 0.08
178 0.09
179 0.1
180 0.1
181 0.16
182 0.16
183 0.22
184 0.31
185 0.38
186 0.47
187 0.56
188 0.59
189 0.63
190 0.68
191 0.72
192 0.7
193 0.71
194 0.7
195 0.7
196 0.74
197 0.71
198 0.67
199 0.61
200 0.59
201 0.55
202 0.54
203 0.5
204 0.5
205 0.47
206 0.47
207 0.46
208 0.42
209 0.41
210 0.41
211 0.39
212 0.37
213 0.33
214 0.3
215 0.28
216 0.28
217 0.26
218 0.23
219 0.24
220 0.29
221 0.36
222 0.39
223 0.44
224 0.48
225 0.53
226 0.58
227 0.64
228 0.63
229 0.63
230 0.68
231 0.7
232 0.75
233 0.72
234 0.63
235 0.53
236 0.45
237 0.37
238 0.31
239 0.28
240 0.19
241 0.2
242 0.23
243 0.27
244 0.36