Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7M4Z2

Protein Details
Accession W7M4Z2    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
245-264HWYNKPSKKATRPSKEDYDYHydrophilic
NLS Segment(s)
Subcellular Location(s) cyto 18.5, cyto_nucl 10.5, mito 3, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR032465  ACMSD  
IPR006680  Amidohydro-rel  
IPR032466  Metal_Hydrolase  
Gene Ontology GO:0016831  F:carboxy-lyase activity  
GO:0016787  F:hydrolase activity  
KEGG fvr:FVEG_04344  -  
Pfam View protein in Pfam  
PF04909  Amidohydro_2  
Amino Acid Sequences MSKRGTIAVEEAIITPSTKWLLEETFSILNPGDSSNKALEAHAAKLLDIHDKRLATMDAEGVEYMLLSLTAPGCQGITNPQLAGKTAKEANDWLACEVAKRPDRFGGLAALSMHDPEEAAQELERAVKQLGFFGALVNDYQSVEGGSGREYFDTAKYDPFWKKVEELDVPIYLHPRYVSIKDLQPGSLYGDRPHLQGAAVQFHLDLSYHIYALCSSGVFDRFPCAKIVAGHLGENIPLNLWRASHWYNKPSKKATRPSKEDYDYYFKHNVYITTSGNFFTPGLKLCIETIGLDRCMYSIDTPYDDIEEAQAWWRTVDLDHDAKEQVGRTNAIKLFKLPLEY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.14
2 0.11
3 0.12
4 0.13
5 0.12
6 0.12
7 0.14
8 0.16
9 0.17
10 0.18
11 0.2
12 0.21
13 0.2
14 0.21
15 0.18
16 0.16
17 0.15
18 0.16
19 0.15
20 0.14
21 0.17
22 0.17
23 0.19
24 0.19
25 0.19
26 0.23
27 0.22
28 0.22
29 0.22
30 0.21
31 0.19
32 0.2
33 0.21
34 0.25
35 0.23
36 0.25
37 0.26
38 0.26
39 0.27
40 0.28
41 0.28
42 0.19
43 0.2
44 0.17
45 0.14
46 0.14
47 0.13
48 0.1
49 0.09
50 0.08
51 0.06
52 0.04
53 0.04
54 0.03
55 0.04
56 0.04
57 0.05
58 0.05
59 0.05
60 0.06
61 0.06
62 0.07
63 0.11
64 0.13
65 0.14
66 0.14
67 0.15
68 0.16
69 0.17
70 0.19
71 0.15
72 0.17
73 0.18
74 0.19
75 0.19
76 0.2
77 0.23
78 0.23
79 0.23
80 0.19
81 0.17
82 0.16
83 0.16
84 0.17
85 0.21
86 0.25
87 0.25
88 0.27
89 0.29
90 0.31
91 0.31
92 0.29
93 0.24
94 0.19
95 0.19
96 0.17
97 0.14
98 0.12
99 0.12
100 0.11
101 0.07
102 0.06
103 0.05
104 0.06
105 0.06
106 0.07
107 0.06
108 0.06
109 0.07
110 0.09
111 0.08
112 0.08
113 0.08
114 0.08
115 0.09
116 0.09
117 0.09
118 0.09
119 0.09
120 0.08
121 0.08
122 0.07
123 0.07
124 0.06
125 0.06
126 0.05
127 0.05
128 0.05
129 0.05
130 0.05
131 0.05
132 0.05
133 0.05
134 0.06
135 0.07
136 0.07
137 0.07
138 0.08
139 0.09
140 0.11
141 0.11
142 0.12
143 0.13
144 0.19
145 0.2
146 0.22
147 0.23
148 0.21
149 0.22
150 0.22
151 0.25
152 0.2
153 0.21
154 0.19
155 0.18
156 0.18
157 0.16
158 0.17
159 0.12
160 0.11
161 0.09
162 0.09
163 0.1
164 0.11
165 0.13
166 0.15
167 0.17
168 0.19
169 0.2
170 0.18
171 0.16
172 0.16
173 0.17
174 0.17
175 0.16
176 0.14
177 0.18
178 0.19
179 0.19
180 0.19
181 0.15
182 0.12
183 0.13
184 0.14
185 0.12
186 0.11
187 0.11
188 0.1
189 0.1
190 0.1
191 0.08
192 0.07
193 0.08
194 0.08
195 0.08
196 0.08
197 0.08
198 0.08
199 0.09
200 0.09
201 0.05
202 0.05
203 0.07
204 0.08
205 0.09
206 0.09
207 0.13
208 0.14
209 0.15
210 0.16
211 0.15
212 0.15
213 0.15
214 0.19
215 0.19
216 0.19
217 0.18
218 0.18
219 0.17
220 0.16
221 0.15
222 0.12
223 0.07
224 0.07
225 0.09
226 0.08
227 0.09
228 0.09
229 0.14
230 0.18
231 0.26
232 0.31
233 0.37
234 0.46
235 0.53
236 0.6
237 0.63
238 0.68
239 0.7
240 0.75
241 0.78
242 0.79
243 0.79
244 0.79
245 0.8
246 0.75
247 0.69
248 0.64
249 0.62
250 0.53
251 0.51
252 0.49
253 0.4
254 0.38
255 0.36
256 0.31
257 0.27
258 0.3
259 0.25
260 0.22
261 0.23
262 0.21
263 0.19
264 0.19
265 0.15
266 0.12
267 0.12
268 0.13
269 0.15
270 0.15
271 0.15
272 0.14
273 0.16
274 0.15
275 0.14
276 0.16
277 0.17
278 0.17
279 0.17
280 0.16
281 0.15
282 0.16
283 0.16
284 0.13
285 0.14
286 0.15
287 0.17
288 0.19
289 0.19
290 0.2
291 0.19
292 0.18
293 0.15
294 0.13
295 0.12
296 0.15
297 0.17
298 0.16
299 0.15
300 0.15
301 0.15
302 0.15
303 0.18
304 0.2
305 0.22
306 0.24
307 0.26
308 0.27
309 0.27
310 0.28
311 0.26
312 0.25
313 0.24
314 0.25
315 0.24
316 0.32
317 0.35
318 0.37
319 0.36
320 0.33
321 0.35