Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7LYB1

Protein Details
Accession W7LYB1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
101-124KSRVLEKTKKRTVHFPQRKFAIKAHydrophilic
NLS Segment(s)
PositionSequence
85-119RPKQTRAIRRRLSPEEKSRVLEKTKKRTVHFPQRK
Subcellular Location(s) nucl 20.5, cyto_nucl 11, mito 6
Family & Domain DBs
InterPro View protein in InterPro  
IPR001854  Ribosomal_L29/L35  
IPR036049  Ribosomal_L29/L35_sf  
IPR045059  RL35  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0000463  P:maturation of LSU-rRNA from tricistronic rRNA transcript (SSU-rRNA, 5.8S rRNA, LSU-rRNA)  
GO:0006412  P:translation  
KEGG fvr:FVEG_01146  -  
Pfam View protein in Pfam  
PF00831  Ribosomal_L29  
CDD cd00427  Ribosomal_L29_HIP  
Amino Acid Sequences MSSGKVKAGALWGKNKDDLTKQLAELKTELGQLRIQKVASSGSKLNRIHDIRKSIARVLTVINAKQRAQLRLFYKNKKYAPLDLRPKQTRAIRRRLSPEEKSRVLEKTKKRTVHFPQRKFAIKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.45
3 0.41
4 0.39
5 0.39
6 0.37
7 0.35
8 0.33
9 0.37
10 0.37
11 0.35
12 0.31
13 0.28
14 0.23
15 0.24
16 0.23
17 0.17
18 0.19
19 0.2
20 0.22
21 0.21
22 0.2
23 0.17
24 0.17
25 0.2
26 0.19
27 0.2
28 0.21
29 0.22
30 0.3
31 0.3
32 0.31
33 0.35
34 0.37
35 0.38
36 0.39
37 0.41
38 0.36
39 0.39
40 0.39
41 0.33
42 0.31
43 0.27
44 0.23
45 0.19
46 0.2
47 0.17
48 0.17
49 0.17
50 0.18
51 0.17
52 0.21
53 0.23
54 0.23
55 0.23
56 0.27
57 0.28
58 0.37
59 0.44
60 0.47
61 0.52
62 0.56
63 0.56
64 0.57
65 0.56
66 0.55
67 0.55
68 0.57
69 0.6
70 0.59
71 0.66
72 0.63
73 0.62
74 0.61
75 0.61
76 0.61
77 0.59
78 0.64
79 0.61
80 0.64
81 0.71
82 0.73
83 0.75
84 0.73
85 0.75
86 0.72
87 0.69
88 0.65
89 0.6
90 0.56
91 0.56
92 0.56
93 0.56
94 0.59
95 0.64
96 0.68
97 0.69
98 0.74
99 0.76
100 0.79
101 0.8
102 0.77
103 0.78
104 0.79