Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MBG6

Protein Details
Accession W7MBG6    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
86-105AAFPKVKRGGKKKLLKIRSTHydrophilic
NLS Segment(s)
PositionSequence
90-101KVKRGGKKKLLK
Subcellular Location(s) mito 25
Family & Domain DBs
KEGG fvr:FVEG_15406  -  
Amino Acid Sequences MTTSMTHLCVVHTVWIRQGRKGDKEGANSSASHYSERLFIICIRAKSSHWLCLHCLRVVTPPQLGICIPSAAQISDTFPCQCSAAAAFPKVKRGGKKKLLKIRSTLITYGAQCQPARAEYGK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.26
2 0.34
3 0.35
4 0.38
5 0.45
6 0.45
7 0.47
8 0.51
9 0.53
10 0.49
11 0.54
12 0.53
13 0.49
14 0.43
15 0.37
16 0.36
17 0.32
18 0.28
19 0.23
20 0.2
21 0.17
22 0.17
23 0.18
24 0.15
25 0.12
26 0.12
27 0.16
28 0.19
29 0.19
30 0.2
31 0.21
32 0.21
33 0.28
34 0.29
35 0.31
36 0.3
37 0.31
38 0.31
39 0.35
40 0.37
41 0.29
42 0.28
43 0.21
44 0.23
45 0.24
46 0.22
47 0.17
48 0.15
49 0.15
50 0.15
51 0.14
52 0.11
53 0.09
54 0.08
55 0.07
56 0.08
57 0.08
58 0.07
59 0.08
60 0.07
61 0.09
62 0.09
63 0.11
64 0.1
65 0.11
66 0.11
67 0.11
68 0.1
69 0.1
70 0.1
71 0.13
72 0.15
73 0.17
74 0.22
75 0.22
76 0.28
77 0.32
78 0.35
79 0.4
80 0.46
81 0.54
82 0.59
83 0.68
84 0.73
85 0.78
86 0.82
87 0.78
88 0.75
89 0.71
90 0.68
91 0.62
92 0.53
93 0.46
94 0.42
95 0.38
96 0.39
97 0.35
98 0.33
99 0.29
100 0.29
101 0.29
102 0.25