Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A1D8PEV4

Protein Details
Accession A0A1D8PEV4   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-31VNVPKTRKTYCKGKECRKHTQHKVTQYKAGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 11, cyto 9, mito_nucl 9
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:0022625  C:cytosolic large ribosomal subunit  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
KEGG cal:CAALFM_C110390CA  -  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNVPKTRKTYCKGKECRKHTQHKVTQYKAGKASLFAQGKRRYDRKQSGYGGQTKQIFHKKAKTTKKVVLRLECVVCKTKAQLPLKRCKHFELGGDKKQKGQALQF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.79
2 0.83
3 0.83
4 0.88
5 0.87
6 0.88
7 0.88
8 0.88
9 0.85
10 0.86
11 0.88
12 0.81
13 0.8
14 0.74
15 0.69
16 0.61
17 0.56
18 0.45
19 0.37
20 0.35
21 0.34
22 0.33
23 0.29
24 0.34
25 0.38
26 0.42
27 0.47
28 0.52
29 0.49
30 0.55
31 0.62
32 0.6
33 0.61
34 0.59
35 0.58
36 0.57
37 0.58
38 0.49
39 0.44
40 0.4
41 0.33
42 0.36
43 0.37
44 0.36
45 0.32
46 0.4
47 0.43
48 0.5
49 0.6
50 0.62
51 0.61
52 0.65
53 0.71
54 0.71
55 0.7
56 0.66
57 0.6
58 0.57
59 0.54
60 0.48
61 0.42
62 0.38
63 0.31
64 0.27
65 0.26
66 0.26
67 0.32
68 0.39
69 0.43
70 0.47
71 0.57
72 0.66
73 0.7
74 0.68
75 0.64
76 0.63
77 0.59
78 0.59
79 0.59
80 0.59
81 0.61
82 0.66
83 0.62
84 0.6
85 0.61
86 0.57