Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

E3S834

Protein Details
Accession E3S834   
Localization Confidence Low
Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
8-33GDKVYLRTKNLRTKRPSKGLNNVKVGHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13.5, mito_nucl 13.166, mito 11.5, cyto_nucl 8.833
Family & Domain DBs
InterPro View protein in InterPro  
IPR016197  Chromo-like_dom_sf  
IPR000953  Chromo/chromo_shadow_dom  
IPR023780  Chromo_domain  
Gene Ontology GO:0006338  P:chromatin remodeling  
KEGG pte:PTT_19047  -  
Pfam View protein in Pfam  
PF00385  Chromo  
PROSITE View protein in PROSITE  
PS50013  CHROMO_2  
CDD cd00024  CD_CSD  
Amino Acid Sequences MAPQLKRGDKVYLRTKNLRTKRPSKGLNNVKVGPFLILNRKGPVTYTLNLPPDARIHPRFHVSLLEPAHPDTPLQKTFHYKTEEENEFKVENIVTHRVVDNGIEYLVKWLGYPDSENT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.67
2 0.72
3 0.74
4 0.78
5 0.79
6 0.77
7 0.77
8 0.8
9 0.81
10 0.82
11 0.8
12 0.81
13 0.82
14 0.81
15 0.78
16 0.71
17 0.62
18 0.54
19 0.46
20 0.36
21 0.27
22 0.21
23 0.22
24 0.22
25 0.23
26 0.24
27 0.24
28 0.23
29 0.23
30 0.25
31 0.22
32 0.19
33 0.21
34 0.24
35 0.25
36 0.26
37 0.25
38 0.21
39 0.19
40 0.21
41 0.22
42 0.22
43 0.23
44 0.24
45 0.26
46 0.26
47 0.24
48 0.24
49 0.2
50 0.21
51 0.2
52 0.2
53 0.18
54 0.19
55 0.19
56 0.16
57 0.15
58 0.12
59 0.15
60 0.17
61 0.18
62 0.19
63 0.26
64 0.28
65 0.34
66 0.36
67 0.32
68 0.34
69 0.41
70 0.45
71 0.41
72 0.39
73 0.36
74 0.32
75 0.31
76 0.27
77 0.19
78 0.15
79 0.16
80 0.19
81 0.16
82 0.18
83 0.18
84 0.17
85 0.17
86 0.16
87 0.14
88 0.11
89 0.1
90 0.09
91 0.09
92 0.11
93 0.11
94 0.11
95 0.09
96 0.1
97 0.11
98 0.13