Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7MWJ9

Protein Details
Accession W7MWJ9    Localization Confidence Medium Confidence Score 13.4
NoLS Segment(s)
PositionSequenceProtein Nature
217-239TLIKEQKSLRRLLKRERRKGARABasic
NLS Segment(s)
PositionSequence
223-239KSLRRLLKRERRKGARA
Subcellular Location(s) nucl 20.5, cyto_nucl 13, cyto 4.5
Family & Domain DBs
KEGG fvr:FVEG_10870  -  
Amino Acid Sequences MSVKYCDSAEEGLPQSYSYDVDSADDESVCSQDSGTCMSPRWGPNAKPELKYSYGPTWNQGHLSYMHNPLGAVPYNLPVNTRWAPQPAPIVCLPPTYDQSRPPQFVSESYESEKRLDPSPNDYPHVKTEHKNYFSPTDVALNELRMADIQLQDEIRTGLNSQRATLSQSSSAVQKQLKQAQKCCEAIKKQLKIVESRCNDHQISVQETKELRGQVMTLIKEQKSLRRLLKRERRKGARA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.21
2 0.19
3 0.17
4 0.16
5 0.12
6 0.1
7 0.1
8 0.11
9 0.11
10 0.12
11 0.13
12 0.12
13 0.11
14 0.11
15 0.11
16 0.1
17 0.09
18 0.08
19 0.08
20 0.09
21 0.13
22 0.15
23 0.16
24 0.16
25 0.19
26 0.24
27 0.25
28 0.31
29 0.34
30 0.33
31 0.41
32 0.5
33 0.53
34 0.5
35 0.52
36 0.5
37 0.47
38 0.47
39 0.43
40 0.41
41 0.41
42 0.39
43 0.4
44 0.39
45 0.37
46 0.36
47 0.31
48 0.26
49 0.22
50 0.25
51 0.24
52 0.24
53 0.23
54 0.21
55 0.21
56 0.19
57 0.2
58 0.17
59 0.14
60 0.11
61 0.11
62 0.13
63 0.13
64 0.13
65 0.11
66 0.16
67 0.17
68 0.18
69 0.18
70 0.2
71 0.21
72 0.23
73 0.29
74 0.23
75 0.25
76 0.24
77 0.25
78 0.22
79 0.22
80 0.21
81 0.16
82 0.19
83 0.19
84 0.2
85 0.22
86 0.29
87 0.34
88 0.34
89 0.32
90 0.31
91 0.29
92 0.29
93 0.31
94 0.27
95 0.24
96 0.24
97 0.26
98 0.24
99 0.25
100 0.25
101 0.2
102 0.2
103 0.21
104 0.2
105 0.24
106 0.3
107 0.3
108 0.31
109 0.31
110 0.3
111 0.3
112 0.34
113 0.3
114 0.26
115 0.32
116 0.38
117 0.4
118 0.39
119 0.39
120 0.37
121 0.36
122 0.34
123 0.26
124 0.21
125 0.17
126 0.18
127 0.16
128 0.13
129 0.12
130 0.11
131 0.1
132 0.07
133 0.08
134 0.07
135 0.08
136 0.08
137 0.08
138 0.08
139 0.09
140 0.09
141 0.09
142 0.08
143 0.07
144 0.08
145 0.1
146 0.15
147 0.15
148 0.15
149 0.16
150 0.17
151 0.2
152 0.21
153 0.19
154 0.16
155 0.17
156 0.17
157 0.18
158 0.19
159 0.2
160 0.2
161 0.22
162 0.28
163 0.36
164 0.42
165 0.46
166 0.52
167 0.54
168 0.6
169 0.59
170 0.56
171 0.56
172 0.53
173 0.57
174 0.6
175 0.57
176 0.55
177 0.55
178 0.53
179 0.52
180 0.53
181 0.53
182 0.48
183 0.48
184 0.47
185 0.5
186 0.47
187 0.41
188 0.4
189 0.34
190 0.37
191 0.37
192 0.33
193 0.32
194 0.32
195 0.33
196 0.33
197 0.29
198 0.23
199 0.19
200 0.19
201 0.19
202 0.25
203 0.24
204 0.25
205 0.31
206 0.3
207 0.36
208 0.38
209 0.41
210 0.4
211 0.47
212 0.51
213 0.55
214 0.63
215 0.68
216 0.77
217 0.8
218 0.86
219 0.89