Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7LGP6

Protein Details
Accession W7LGP6    Localization Confidence High Confidence Score 15.1
NoLS Segment(s)
PositionSequenceProtein Nature
67-86VPPPRPPRSPSPRQPSPRRDBasic
NLS Segment(s)
PositionSequence
44-92PTRRRDHGPRVVARKSPRQHPIRVPPPRPPRSPSPRQPSPRRDADIVRA
95-95R
Subcellular Location(s) nucl 19.5, cyto_nucl 13, cyto 5.5
Family & Domain DBs
KEGG fvr:FVEG_01783  -  
Amino Acid Sequences MSTPHNYPEEEEDFSEFYNNPLYKRVSDLTDHQRKHACPPPPLPTRRRDHGPRVVARKSPRQHPIRVPPPRPPRSPSPRQPSPRRDADIVRASIRRHSFAKPRQTPNKEDAPEPEIGHGAIFNAHVERNFQQNVDRVLGPEHVDKYENCADMVEKAKEELEDKPEGSHRLGRPWTKEEFDKAARLTE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.25
3 0.18
4 0.16
5 0.21
6 0.21
7 0.19
8 0.24
9 0.26
10 0.25
11 0.3
12 0.32
13 0.27
14 0.29
15 0.36
16 0.42
17 0.49
18 0.48
19 0.48
20 0.52
21 0.5
22 0.55
23 0.54
24 0.51
25 0.48
26 0.54
27 0.59
28 0.62
29 0.68
30 0.66
31 0.67
32 0.67
33 0.67
34 0.69
35 0.67
36 0.67
37 0.69
38 0.72
39 0.7
40 0.71
41 0.68
42 0.65
43 0.63
44 0.63
45 0.59
46 0.58
47 0.6
48 0.58
49 0.6
50 0.63
51 0.68
52 0.69
53 0.74
54 0.69
55 0.7
56 0.75
57 0.75
58 0.7
59 0.64
60 0.64
61 0.63
62 0.7
63 0.69
64 0.68
65 0.7
66 0.75
67 0.8
68 0.78
69 0.76
70 0.73
71 0.66
72 0.6
73 0.52
74 0.51
75 0.47
76 0.4
77 0.36
78 0.32
79 0.28
80 0.31
81 0.3
82 0.26
83 0.22
84 0.25
85 0.32
86 0.37
87 0.48
88 0.5
89 0.58
90 0.66
91 0.68
92 0.68
93 0.63
94 0.65
95 0.55
96 0.48
97 0.42
98 0.36
99 0.33
100 0.29
101 0.25
102 0.17
103 0.15
104 0.14
105 0.11
106 0.07
107 0.05
108 0.05
109 0.05
110 0.05
111 0.06
112 0.06
113 0.1
114 0.11
115 0.15
116 0.16
117 0.16
118 0.18
119 0.22
120 0.25
121 0.25
122 0.24
123 0.2
124 0.21
125 0.22
126 0.21
127 0.2
128 0.19
129 0.17
130 0.18
131 0.18
132 0.23
133 0.27
134 0.25
135 0.22
136 0.21
137 0.2
138 0.22
139 0.28
140 0.23
141 0.18
142 0.18
143 0.19
144 0.19
145 0.21
146 0.2
147 0.2
148 0.21
149 0.21
150 0.24
151 0.27
152 0.29
153 0.3
154 0.34
155 0.32
156 0.37
157 0.44
158 0.48
159 0.5
160 0.52
161 0.55
162 0.52
163 0.54
164 0.52
165 0.52
166 0.49
167 0.49