Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M5T1

Protein Details
Accession W7M5T1    Localization Confidence Medium Confidence Score 12.6
NoLS Segment(s)
PositionSequenceProtein Nature
155-190NSYALKRKSTTSKKQKEKKKHGKKLDVDKRKQVSNKBasic
NLS Segment(s)
PositionSequence
160-188KRKSTTSKKQKEKKKHGKKLDVDKRKQVS
Subcellular Location(s) nucl 22.5, cyto_nucl 13.333, mito_nucl 13.166
Family & Domain DBs
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
KEGG fvr:FVEG_15506  -  
Amino Acid Sequences MVNKRHTAHEPQPSTPASKAIEPLHPRSRWSEWALHNSGLYYYRARYISFEDISSIPPTGRNSIVPNVQGGYIHYQSMSVNEVTSRGSSQAPELATCSTVTTPTASDPPVSTQEVYGQQNDQLVVSTKTTKDSMLMSGALQPEADTTETVVVIPNSYALKRKSTTSKKQKEKKKHGKKLDVDKRKQVSNKAKVNKWLDTL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.52
2 0.45
3 0.41
4 0.32
5 0.3
6 0.32
7 0.3
8 0.37
9 0.38
10 0.45
11 0.49
12 0.48
13 0.48
14 0.49
15 0.51
16 0.48
17 0.47
18 0.47
19 0.44
20 0.52
21 0.53
22 0.47
23 0.42
24 0.37
25 0.33
26 0.27
27 0.23
28 0.17
29 0.14
30 0.18
31 0.19
32 0.19
33 0.2
34 0.23
35 0.27
36 0.26
37 0.25
38 0.23
39 0.23
40 0.24
41 0.23
42 0.18
43 0.12
44 0.14
45 0.16
46 0.16
47 0.16
48 0.16
49 0.18
50 0.21
51 0.24
52 0.22
53 0.21
54 0.18
55 0.17
56 0.16
57 0.14
58 0.15
59 0.13
60 0.12
61 0.11
62 0.11
63 0.11
64 0.12
65 0.13
66 0.08
67 0.07
68 0.07
69 0.08
70 0.08
71 0.09
72 0.08
73 0.07
74 0.08
75 0.08
76 0.09
77 0.11
78 0.1
79 0.1
80 0.11
81 0.1
82 0.1
83 0.09
84 0.1
85 0.07
86 0.07
87 0.07
88 0.06
89 0.06
90 0.07
91 0.08
92 0.08
93 0.08
94 0.09
95 0.11
96 0.13
97 0.14
98 0.13
99 0.12
100 0.14
101 0.19
102 0.19
103 0.18
104 0.16
105 0.15
106 0.16
107 0.16
108 0.13
109 0.09
110 0.09
111 0.1
112 0.11
113 0.12
114 0.12
115 0.14
116 0.15
117 0.14
118 0.13
119 0.13
120 0.14
121 0.13
122 0.13
123 0.11
124 0.13
125 0.14
126 0.12
127 0.11
128 0.09
129 0.08
130 0.09
131 0.09
132 0.06
133 0.07
134 0.07
135 0.07
136 0.07
137 0.08
138 0.07
139 0.07
140 0.07
141 0.08
142 0.09
143 0.1
144 0.16
145 0.16
146 0.22
147 0.23
148 0.29
149 0.38
150 0.47
151 0.57
152 0.63
153 0.72
154 0.77
155 0.85
156 0.9
157 0.91
158 0.92
159 0.93
160 0.93
161 0.93
162 0.93
163 0.94
164 0.93
165 0.93
166 0.93
167 0.93
168 0.89
169 0.88
170 0.82
171 0.8
172 0.77
173 0.76
174 0.76
175 0.75
176 0.77
177 0.76
178 0.77
179 0.79
180 0.79