Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7MYS4

Protein Details
Accession W7MYS4    Localization Confidence Low Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
60-91RPKGLRKGDRHKVEKKPQKPQKRLRLWVRVSEBasic
NLS Segment(s)
PositionSequence
56-84RVRERPKGLRKGDRHKVEKKPQKPQKRLR
Subcellular Location(s) mito 14.5, mito_nucl 11.999, nucl 8, cyto_nucl 7.333
Family & Domain DBs
KEGG fvr:FVEG_11507  -  
Amino Acid Sequences MNITDQQQLLCLISRSINVLGCSARSKCPYVQPLRLQLRQLQTLTAVFGSEEEEGRVRERPKGLRKGDRHKVEKKPQKPQKRLRLWVRVSEEYAGVSHVESLREISQSSPGLNRCQT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.15
3 0.16
4 0.17
5 0.16
6 0.17
7 0.16
8 0.17
9 0.21
10 0.2
11 0.23
12 0.23
13 0.26
14 0.27
15 0.35
16 0.42
17 0.45
18 0.51
19 0.52
20 0.59
21 0.63
22 0.63
23 0.57
24 0.53
25 0.5
26 0.46
27 0.41
28 0.31
29 0.25
30 0.22
31 0.21
32 0.15
33 0.11
34 0.06
35 0.06
36 0.07
37 0.06
38 0.06
39 0.06
40 0.07
41 0.07
42 0.09
43 0.12
44 0.12
45 0.15
46 0.19
47 0.26
48 0.34
49 0.43
50 0.48
51 0.54
52 0.61
53 0.68
54 0.73
55 0.75
56 0.74
57 0.74
58 0.77
59 0.78
60 0.8
61 0.79
62 0.81
63 0.82
64 0.85
65 0.87
66 0.87
67 0.87
68 0.88
69 0.89
70 0.87
71 0.88
72 0.81
73 0.79
74 0.76
75 0.68
76 0.59
77 0.5
78 0.41
79 0.31
80 0.27
81 0.19
82 0.13
83 0.1
84 0.1
85 0.1
86 0.1
87 0.1
88 0.13
89 0.13
90 0.14
91 0.14
92 0.13
93 0.17
94 0.18
95 0.2
96 0.23
97 0.24