Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7M816

Protein Details
Accession W7M816   
Localization Confidence Medium
Confidence Score 12.3
NoLS Segment(s)
PositionSequenceProtein Nature
75-109EKERVKKEYEEKQKKKKEKEEKKDKEKDKDKKEKDBasic
NLS Segment(s)
PositionSequence
64-123AKRKRERELEEEKERVKKEYEEKQKKKKEKEEKKDKEKDKDKKEKDGDKEKDKEEKDEKK
Subcellular Location(s) nucl 16.5, cyto_nucl 11.5, cyto 5.5, mito 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013640  Vfa1  
KEGG fvr:FVEG_03237  -  
Pfam View protein in Pfam  
PF08432  Vfa1  
Amino Acid Sequences MATTFPNIYTLRKVADTAAKACDICYKSSTSVLITPDQKDFFFVCPVHLKDRYFCTPKIDEEAAKRKRERELEEEKERVKKEYEEKQKKKKEKEEKKDKEKDKDKKEKDGDKEKDKEEKDEKKDEDKDKEDKTPPAEEEPRVFELKTAFYQQRLLKKRQAEAAKADRERASKPGYFPSVPSDAPSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.31
3 0.32
4 0.29
5 0.3
6 0.29
7 0.28
8 0.28
9 0.31
10 0.26
11 0.24
12 0.24
13 0.24
14 0.24
15 0.26
16 0.27
17 0.22
18 0.23
19 0.23
20 0.27
21 0.27
22 0.27
23 0.29
24 0.29
25 0.27
26 0.26
27 0.25
28 0.21
29 0.22
30 0.2
31 0.2
32 0.25
33 0.27
34 0.3
35 0.33
36 0.32
37 0.31
38 0.37
39 0.42
40 0.4
41 0.38
42 0.39
43 0.37
44 0.38
45 0.41
46 0.36
47 0.31
48 0.34
49 0.44
50 0.44
51 0.48
52 0.48
53 0.45
54 0.5
55 0.54
56 0.52
57 0.5
58 0.53
59 0.55
60 0.59
61 0.6
62 0.56
63 0.55
64 0.5
65 0.43
66 0.35
67 0.31
68 0.33
69 0.39
70 0.47
71 0.53
72 0.61
73 0.7
74 0.77
75 0.81
76 0.83
77 0.83
78 0.83
79 0.83
80 0.86
81 0.87
82 0.88
83 0.9
84 0.9
85 0.87
86 0.86
87 0.85
88 0.84
89 0.83
90 0.84
91 0.77
92 0.78
93 0.79
94 0.77
95 0.75
96 0.76
97 0.72
98 0.7
99 0.71
100 0.64
101 0.64
102 0.57
103 0.56
104 0.55
105 0.57
106 0.54
107 0.57
108 0.57
109 0.57
110 0.64
111 0.63
112 0.62
113 0.58
114 0.59
115 0.54
116 0.58
117 0.54
118 0.5
119 0.47
120 0.44
121 0.41
122 0.42
123 0.42
124 0.37
125 0.36
126 0.36
127 0.36
128 0.33
129 0.3
130 0.24
131 0.22
132 0.23
133 0.23
134 0.24
135 0.22
136 0.22
137 0.29
138 0.33
139 0.41
140 0.45
141 0.48
142 0.49
143 0.53
144 0.57
145 0.59
146 0.61
147 0.56
148 0.58
149 0.61
150 0.64
151 0.59
152 0.59
153 0.55
154 0.51
155 0.48
156 0.45
157 0.42
158 0.37
159 0.38
160 0.42
161 0.45
162 0.43
163 0.42
164 0.42
165 0.4
166 0.37