Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

W7LX70

Protein Details
Accession W7LX70    Localization Confidence High Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
12-60GGALKLKGAKINKKKKKRDKTDLEKNLDSGNKDEEKRKKKKSEDGEEQEBasic
NLS Segment(s)
PositionSequence
16-52KLKGAKINKKKKKRDKTDLEKNLDSGNKDEEKRKKKK
86-87KK
Subcellular Location(s) nucl 23.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR013865  FAM32A  
KEGG fvr:FVEG_04759  -  
Pfam View protein in Pfam  
PF08555  FAM32A  
Amino Acid Sequences MGSDDYAAVGGGGALKLKGAKINKKKKKRDKTDLEKNLDSGNKDEEKRKKKKSEDGEEQEPHGEDDEDNPEVQKTEAQKRHEEIKKKRLLKLAESSSSRPELLKTHKERVEELNTYLSRLSEHHDMPRIGPG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.05
2 0.05
3 0.06
4 0.07
5 0.13
6 0.2
7 0.31
8 0.41
9 0.53
10 0.63
11 0.73
12 0.83
13 0.89
14 0.93
15 0.93
16 0.94
17 0.94
18 0.94
19 0.94
20 0.93
21 0.89
22 0.79
23 0.69
24 0.62
25 0.53
26 0.44
27 0.34
28 0.29
29 0.27
30 0.27
31 0.34
32 0.4
33 0.48
34 0.56
35 0.64
36 0.68
37 0.7
38 0.78
39 0.8
40 0.8
41 0.81
42 0.78
43 0.77
44 0.69
45 0.62
46 0.53
47 0.43
48 0.33
49 0.23
50 0.16
51 0.08
52 0.08
53 0.1
54 0.09
55 0.09
56 0.09
57 0.08
58 0.08
59 0.09
60 0.1
61 0.12
62 0.21
63 0.27
64 0.3
65 0.33
66 0.36
67 0.45
68 0.49
69 0.55
70 0.55
71 0.59
72 0.65
73 0.66
74 0.69
75 0.66
76 0.64
77 0.6
78 0.6
79 0.56
80 0.53
81 0.52
82 0.49
83 0.45
84 0.43
85 0.37
86 0.29
87 0.24
88 0.24
89 0.29
90 0.37
91 0.4
92 0.47
93 0.5
94 0.52
95 0.53
96 0.54
97 0.53
98 0.46
99 0.42
100 0.41
101 0.38
102 0.37
103 0.35
104 0.28
105 0.21
106 0.19
107 0.22
108 0.2
109 0.23
110 0.28
111 0.35
112 0.35