Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

W7MD69

Protein Details
Accession W7MD69    Localization Confidence Medium Confidence Score 13
NoLS Segment(s)
PositionSequenceProtein Nature
136-165KDDAEKESAKNRKPKKKAKKIKLSFDEDEGBasic
NLS Segment(s)
PositionSequence
105-118IGGRKRKVGKVIGE
123-157AKDEDKGEDKKKEKDDAEKESAKNRKPKKKAKKIK
Subcellular Location(s) cyto 13.5, cyto_nucl 13, nucl 11.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027911  DUF4604  
KEGG fvr:FVEG_08988  -  
Pfam View protein in Pfam  
PF15377  DUF4604  
Amino Acid Sequences MAPKINSKNLSYDTEAAAPPFLAALRAQAAGATGPNPLLAAQRRSAKKRSSSEEAEDVPLVVDEDGNVVSLEVDKDGVVKDNGDYDVEPATEKETAKESESKAAIGGRKRKVGKVIGEAADEAKDEDKGEDKKKEKDDAEKESAKNRKPKKKAKKIKLSFDEDEG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.34
2 0.33
3 0.27
4 0.23
5 0.18
6 0.13
7 0.12
8 0.09
9 0.07
10 0.06
11 0.08
12 0.09
13 0.09
14 0.09
15 0.09
16 0.09
17 0.09
18 0.09
19 0.08
20 0.06
21 0.06
22 0.06
23 0.06
24 0.06
25 0.11
26 0.14
27 0.16
28 0.21
29 0.29
30 0.35
31 0.4
32 0.47
33 0.49
34 0.54
35 0.59
36 0.61
37 0.61
38 0.59
39 0.58
40 0.56
41 0.5
42 0.43
43 0.36
44 0.28
45 0.21
46 0.16
47 0.12
48 0.07
49 0.05
50 0.03
51 0.04
52 0.04
53 0.04
54 0.04
55 0.04
56 0.04
57 0.04
58 0.04
59 0.04
60 0.04
61 0.03
62 0.04
63 0.04
64 0.06
65 0.06
66 0.06
67 0.06
68 0.07
69 0.07
70 0.07
71 0.07
72 0.07
73 0.07
74 0.07
75 0.07
76 0.06
77 0.07
78 0.09
79 0.09
80 0.09
81 0.11
82 0.12
83 0.14
84 0.18
85 0.18
86 0.21
87 0.21
88 0.2
89 0.18
90 0.2
91 0.22
92 0.24
93 0.31
94 0.3
95 0.37
96 0.39
97 0.41
98 0.44
99 0.46
100 0.44
101 0.43
102 0.45
103 0.39
104 0.37
105 0.35
106 0.3
107 0.24
108 0.2
109 0.14
110 0.09
111 0.08
112 0.08
113 0.08
114 0.14
115 0.19
116 0.26
117 0.34
118 0.38
119 0.46
120 0.51
121 0.58
122 0.56
123 0.61
124 0.63
125 0.62
126 0.66
127 0.64
128 0.61
129 0.62
130 0.66
131 0.63
132 0.64
133 0.66
134 0.69
135 0.73
136 0.82
137 0.85
138 0.88
139 0.92
140 0.94
141 0.95
142 0.94
143 0.95
144 0.93
145 0.9